KEGG   Thielavia terrestris: THITE_2112932Help
Entry
THITE_2112932     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2112932
   01230 Biosynthesis of amino acids
    THITE_2112932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2112932
   00030 Pentose phosphate pathway
    THITE_2112932
   00051 Fructose and mannose metabolism
    THITE_2112932
   00052 Galactose metabolism
    THITE_2112932
  Energy metabolism
   00680 Methane metabolism
    THITE_2112932
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THITE_2112932
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THITE_2112932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(3075186..3075899,3076004..3076471,3076571..3077698,3077764..3077811)
Genome map
AA seq 785 aa AA seqDB search
MAAKKKIAIMTSGGDSPGMNGFVRACVRMAIHLGCDPYCIYEGYEGLVRGGNLIRKMEWH
DVRGWLSEGGTLIGTARCMAFYERAGRLAAARNLISEGIDALIICGGDGSLTGADRFRAE
WPSLIKELEDNGEFTAQQLEPYRHLNIVGLVGSIDNDLSGTDATIGCYSALARICHAVDL
IEATASSHSRAFVIEVMGRHCGWLALMAGVATGADFIFIPEKPRADNWREEMCSIVEHHR
KLGKRKTIVIIAEGALDREGNKITPTMVKDLLADKNGLGLDTRITTLGHVQRGGTAVAYD
RMLATLQGVEAVKAVLEATPDTPTWVIAINENKIVRKPLMQAVQDTKRVAKAIENQDFDL
AMSLRDSEFSEQYKSFMMTTAVQLNKDLLLPEKERMRIGFINVGAPAGGMNAAVRAGVAY
CLSRGHEPIAIYNGFAGFARHHGDKPLGAVRNFDWLEVDGWASKGGSEIGTNRELPSESG
METVANLIEHYQFDALFLIGGFEAFHAVSQLRKARDQYPSLCIPITLLPATISNNVPGTE
YSLGSDTCLNELVEYCDKIKQSASATRRRVFVIETQGGRSGYVATLGGLGVGASAVYTPE
EGVSLEMLAADVRHLKEVFAQDKGQSRAGRLILINEKASKVYNARLIAEILREEAHGRFE
SREAIPGHMQQGGVPSPMDRCRAVRLAIRCIQHLEQYGRNVHNRVKTDPMSATVIGIRGA
SVVFTPITKVEEDETDWPNRRPKSAFWTEMKEIVDILGGRPSHTAPEPDLTGLKAKDVKR
GIENV
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaaaagaagatcgccatcatgacctcgggcggcgactcgcccggcatgaac
ggtttcgtccgcgcctgcgtgcgcatggctatccacctcggttgtgacccctactgcatt
tacgaaggctacgagggcctcgtccgcggcggaaacctgatacgcaagatggaatggcac
gatgtgcgcggctggctgtccgagggcggcacgctgatcggcaccgcccgctgcatggcc
ttctacgaacgcgcaggccgcctagcggctgcgaggaacctgatctcggaaggcatcgac
gccctcatcatctgcggaggcgacggctcgctcaccggagccgacaggttccgtgctgaa
tggccctcgctgatcaaggagctcgaggacaacggcgagttcacggcgcagcagctcgaa
ccctacagacacctcaacatcgtcggcctggtcggatctattgacaacgacctgtctggc
acggatgccaccattggctgctactcggctctggcgcgtatctgccacgccgtggatctc
attgaggccacggcttcctcgcattcccgcgccttcgtcatcgaggtcatggggagacac
tgcggttggctggcactgatggctggtgttgcgaccggtgcggatttcatcttcattcca
gagaagcctagggcggataactggcgggaggaaatgtgcagcatagtcgaacatcaccgg
aaactcggcaaacggaaaaccatcgtcattatcgccgagggcgccctcgaccgagaaggc
aacaagatcacgcccaccatggtgaaggaccttcttgccgacaagaacgggcttgggctc
gacacccgaatcaccacactcggccacgtccagcgtggtggcactgcggtcgcatacgac
cgcatgctggcaacgctgcagggcgttgaggctgtcaaggccgtcctggaggctacgccg
gacacgccaacttgggtcatcgctatcaacgagaacaagattgtccggaagccactcatg
caggcggtgcaggacaccaagagggtggccaaggcgatagagaaccaggactttgacctg
gccatgtcgctacgcgactctgagttctctgagcagtacaagtcgttcatgatgacgacg
gcggttcaactgaacaaagatctcctgctgccagagaaggagcgcatgaggattggcttc
atcaatgtgggcgcgcctgcaggtggcatgaatgcggcagttcgcgccggtgtagcatac
tgcttgtcccgggggcacgagcctatcgccatctacaatggctttgccgggtttgcgcgt
caccatggagacaagccgctaggtgccgtgcggaacttcgactggctcgaggtcgacggc
tgggcgagcaaaggcggttccgagataggaacgaaccgcgagcttcccagcgagtcgggc
atggagaccgtcgccaacctgatcgagcactaccagttcgacgccctgttcctcatcgga
gggtttgaggccttccacgccgtctcccagctgcggaaggctcgggaccagtacccatcc
ctctgcatccccatcacgctcctgcccgccaccatctccaacaacgtgccgggcaccgag
tactcgctgggctccgacacgtgcctcaacgagctggtcgagtactgcgacaagatcaag
cagtcggcctcggccacgcggcggcgcgtgttcgtcatcgagacccagggcggccgctcc
ggctacgtggccacgctcggcggcctcggcgtcggcgcctccgccgtctacacgcccgaa
gagggcgtcagcctggagatgctggcggccgacgtgcgccacctcaaggaggtcttcgcg
caagacaagggccagtcgcgcgccggccggctgatcctgatcaacgagaaggcgtccaag
gtgtacaacgcgcgactgatcgccgagatcctccgcgaggaggcgcacggccggttcgag
agccgcgaggccatcccgggccacatgcagcagggcggcgtgccgtcgccgatggaccgc
tgccgcgcggtgcgcctcgcgatccgctgcatccagcacctcgagcagtacggccgcaac
gtgcacaaccgcgtcaagacggaccccatgagcgccaccgtcatcggcatcaggggcgcc
agcgtcgtcttcacccccatcaccaaggtcgaggaggacgagaccgactggccgaaccgg
aggcccaagtccgccttctggaccgagatgaaggagattgtcgatatcctcggcggaagg
cccagccacaccgctcccgagcccgacctgaccgggcttaaggctaaggatgtgaagcgg
ggcattgagaacgtctag

DBGET integrated database retrieval system