KEGG   Thielavia terrestris: THITE_2112932Help
Entry
THITE_2112932     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt00030  Pentose phosphate pathway
ttt00051  Fructose and mannose metabolism
ttt00052  Galactose metabolism
ttt00680  Methane metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
ttt01200  Carbon metabolism
ttt01230  Biosynthesis of amino acids
ttt03018  RNA degradation
Module
ttt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2112932
   00030 Pentose phosphate pathway
    THITE_2112932
   00051 Fructose and mannose metabolism
    THITE_2112932
   00052 Galactose metabolism
    THITE_2112932
  Energy metabolism
   00680 Methane metabolism
    THITE_2112932
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    THITE_2112932
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     THITE_2112932
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THITE_2112932
Messenger RNA biogenesis [BR:ttt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     THITE_2112932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK UVR
Motif
Other DBs
NCBI-GeneID: 11520510
NCBI-ProteinID: XP_003652028
JGI: Thite2_2112932
UniProt: G2R0Z8
Position
2:join(3075186..3075899,3076004..3076471,3076571..3077698,3077764..3077811)
Genome map
AA seq 785 aa AA seqDB search
MAAKKKIAIMTSGGDSPGMNGFVRACVRMAIHLGCDPYCIYEGYEGLVRGGNLIRKMEWH
DVRGWLSEGGTLIGTARCMAFYERAGRLAAARNLISEGIDALIICGGDGSLTGADRFRAE
WPSLIKELEDNGEFTAQQLEPYRHLNIVGLVGSIDNDLSGTDATIGCYSALARICHAVDL
IEATASSHSRAFVIEVMGRHCGWLALMAGVATGADFIFIPEKPRADNWREEMCSIVEHHR
KLGKRKTIVIIAEGALDREGNKITPTMVKDLLADKNGLGLDTRITTLGHVQRGGTAVAYD
RMLATLQGVEAVKAVLEATPDTPTWVIAINENKIVRKPLMQAVQDTKRVAKAIENQDFDL
AMSLRDSEFSEQYKSFMMTTAVQLNKDLLLPEKERMRIGFINVGAPAGGMNAAVRAGVAY
CLSRGHEPIAIYNGFAGFARHHGDKPLGAVRNFDWLEVDGWASKGGSEIGTNRELPSESG
METVANLIEHYQFDALFLIGGFEAFHAVSQLRKARDQYPSLCIPITLLPATISNNVPGTE
YSLGSDTCLNELVEYCDKIKQSASATRRRVFVIETQGGRSGYVATLGGLGVGASAVYTPE
EGVSLEMLAADVRHLKEVFAQDKGQSRAGRLILINEKASKVYNARLIAEILREEAHGRFE
SREAIPGHMQQGGVPSPMDRCRAVRLAIRCIQHLEQYGRNVHNRVKTDPMSATVIGIRGA
SVVFTPITKVEEDETDWPNRRPKSAFWTEMKEIVDILGGRPSHTAPEPDLTGLKAKDVKR
GIENV
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaaaagaagatcgccatcatgacctcgggcggcgactcgcccggcatgaac
ggtttcgtccgcgcctgcgtgcgcatggctatccacctcggttgtgacccctactgcatt
tacgaaggctacgagggcctcgtccgcggcggaaacctgatacgcaagatggaatggcac
gatgtgcgcggctggctgtccgagggcggcacgctgatcggcaccgcccgctgcatggcc
ttctacgaacgcgcaggccgcctagcggctgcgaggaacctgatctcggaaggcatcgac
gccctcatcatctgcggaggcgacggctcgctcaccggagccgacaggttccgtgctgaa
tggccctcgctgatcaaggagctcgaggacaacggcgagttcacggcgcagcagctcgaa
ccctacagacacctcaacatcgtcggcctggtcggatctattgacaacgacctgtctggc
acggatgccaccattggctgctactcggctctggcgcgtatctgccacgccgtggatctc
attgaggccacggcttcctcgcattcccgcgccttcgtcatcgaggtcatggggagacac
tgcggttggctggcactgatggctggtgttgcgaccggtgcggatttcatcttcattcca
gagaagcctagggcggataactggcgggaggaaatgtgcagcatagtcgaacatcaccgg
aaactcggcaaacggaaaaccatcgtcattatcgccgagggcgccctcgaccgagaaggc
aacaagatcacgcccaccatggtgaaggaccttcttgccgacaagaacgggcttgggctc
gacacccgaatcaccacactcggccacgtccagcgtggtggcactgcggtcgcatacgac
cgcatgctggcaacgctgcagggcgttgaggctgtcaaggccgtcctggaggctacgccg
gacacgccaacttgggtcatcgctatcaacgagaacaagattgtccggaagccactcatg
caggcggtgcaggacaccaagagggtggccaaggcgatagagaaccaggactttgacctg
gccatgtcgctacgcgactctgagttctctgagcagtacaagtcgttcatgatgacgacg
gcggttcaactgaacaaagatctcctgctgccagagaaggagcgcatgaggattggcttc
atcaatgtgggcgcgcctgcaggtggcatgaatgcggcagttcgcgccggtgtagcatac
tgcttgtcccgggggcacgagcctatcgccatctacaatggctttgccgggtttgcgcgt
caccatggagacaagccgctaggtgccgtgcggaacttcgactggctcgaggtcgacggc
tgggcgagcaaaggcggttccgagataggaacgaaccgcgagcttcccagcgagtcgggc
atggagaccgtcgccaacctgatcgagcactaccagttcgacgccctgttcctcatcgga
gggtttgaggccttccacgccgtctcccagctgcggaaggctcgggaccagtacccatcc
ctctgcatccccatcacgctcctgcccgccaccatctccaacaacgtgccgggcaccgag
tactcgctgggctccgacacgtgcctcaacgagctggtcgagtactgcgacaagatcaag
cagtcggcctcggccacgcggcggcgcgtgttcgtcatcgagacccagggcggccgctcc
ggctacgtggccacgctcggcggcctcggcgtcggcgcctccgccgtctacacgcccgaa
gagggcgtcagcctggagatgctggcggccgacgtgcgccacctcaaggaggtcttcgcg
caagacaagggccagtcgcgcgccggccggctgatcctgatcaacgagaaggcgtccaag
gtgtacaacgcgcgactgatcgccgagatcctccgcgaggaggcgcacggccggttcgag
agccgcgaggccatcccgggccacatgcagcagggcggcgtgccgtcgccgatggaccgc
tgccgcgcggtgcgcctcgcgatccgctgcatccagcacctcgagcagtacggccgcaac
gtgcacaaccgcgtcaagacggaccccatgagcgccaccgtcatcggcatcaggggcgcc
agcgtcgtcttcacccccatcaccaaggtcgaggaggacgagaccgactggccgaaccgg
aggcccaagtccgccttctggaccgagatgaaggagattgtcgatatcctcggcggaagg
cccagccacaccgctcccgagcccgacctgaccgggcttaaggctaaggatgtgaagcgg
ggcattgagaacgtctag

DBGET integrated database retrieval system