KEGG   Thielavia terrestris: THITE_2113236Help
Entry
THITE_2113236     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(3461583..3463541)
Genome map
AA seq 652 aa AA seqDB search
MPDKTLKVVTYAAGASLAAITLIYVFGPTYFLDSDTSSSLGGAFSTRKKGIVGLENPAND
CFINSVLQALAGLGDLRLYLIREVHRRSLDDGSIYSQLVPPAALAGEEGEAAPVRFGKDI
PAWKLEGLQRGSVTKGLKEILDALNERPIYKKTISAAPFVRTLEEAFRQRVSRQQQDAQE
FLQVVAERLCDEYHAGRRARLFATRTATVDDCWPSRTSNHGGATGSASPIAASQHVAPDL
AREGAVGSVEDVRGFEKERRGEDEEGFPLQGRVESQIECLTCGFTPRPTASTFCTLTLHV
PQVPATTLGACFDGMFKTEYIDDFKCEKCRLLHALALFESDEQRSASEAVRRKARAAVES
LRAAIETDPENPPEGVTLPDLRYAPRRRIARHFRITEFPRILAIHLSRSIFDVGRSSQKN
SAKVAFPEELRLGGLLQQRKYKLLGLVTHKGSHHSGHYESFRRQTVYPPFSNPSTFQVSG
VYSRTASPAPGPRGATAEAAAQALVQDPPSRDIEAIQTGPSPCLASTPARSAPDSPPAGS
AHGEHSADSRCPTPAAGTRTQPTGTVTRGSTEVSPHSSSVETAYSPSLVEAAEPMPATAR
LEVAAKRKQPKQQARWWRISDDKVKEASTREVLGMQREVYLLFYELERPRMP
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaagacgctcaaagttgtcacatatgccgccggtgcctctctcgcggcaatc
actttgatctatgtcttcggtccgacatacttcctcgacagcgacacttccagctctctc
ggtggcgcattctcgacccgaaagaaaggcatcgtgggactcgagaaccccgcaaacgat
tgctttatcaactcggtactccaggctcttgccgggcttggagatcttcggttatatttg
atacgcgaggtacatcgccgttctctcgacgacggatcgatatactcgcaactcgtccca
ccggcggcattggcgggagaggaaggcgaggcggccccggttcggttcggcaaagacata
ccagcctggaaattggagggattgcaaagaggtagtgtcaccaagggcttgaaggagatt
ctggacgctttaaatgagcgccctatctacaaaaaaaccatttccgcggcaccgttcgtc
aggacgctggaagaagctttcaggcaacgggtcagccggcagcagcaggatgcccaagag
ttcctccaggtggtggcggagaggctgtgcgacgagtaccatgcgggccgcagggcccgg
ttgtttgccactcgcacagcgaccgtggatgactgctggccctcgagaacgagcaaccac
ggcggtgcgacgggctcagcttcgcccatcgcggctagccaacatgtagcaccagatctg
gctcgtgagggagctgtcggcagtgtcgaagacgtgaggggctttgaaaaggagcgacgc
ggggaagatgaggaggggttccctctgcagggccgggttgagtcacaaatcgagtgcttg
acttgcggcttcacccctcgacccacggcatccaccttctgcaccttgacgctccatgtg
ccccaagtccccgcgaccaccctaggcgcatgcttcgacggcatgttcaagacagagtac
atcgacgacttcaaatgtgaaaagtgtcgcctcttgcatgctctggccctcttcgagtcc
gacgagcagcggtcagcatccgaagccgtgaggaggaaagctcgcgctgccgtggagagc
cttcgggctgccattgagacggatccagagaacccccccgagggcgtcacgctccccgac
ctgcgatacgcgccccggcgccgaatagcgcgtcattttcggattaccgagtttcccagg
atcctggctatccatctgtccaggtccatattcgatgtcggccgctcgtcgcaaaagaac
tcggccaaggtggcatttccagaggaattgcgcctcgggggcttactccagcagcggaag
tacaagctgctgggcctcgtgacacacaagggaagccaccatagtgggcactacgaatcc
ttccggcgtcagaccgtgtacccgcctttctccaacccaagcacattccaggtctccggg
gtgtacagcagaacggccagtcccgccccgggccctcgcggggctactgcagaagctgca
gcccaagctctcgtacaagaccctccaagccgcgatatcgaggccatccagaccggtcct
tccccttgtctggcatcaactcctgcgagaagcgccccagactcaccacccgccggttcg
gcccacggggagcactcagcagactcaaggtgtcccacaccagctgctgggactcgcact
cagcccaccggtacggtcactcgggggtcgaccgaggtatccccgcattcgagctccgtc
gagactgcgtactcgccctcgctcgttgaagcagccgagcccatgccagccaccgcgcgg
cttgaggtggctgcaaagcgcaagcagccgaagcagcaagcccgttggtggcggatcagc
gacgataaggtcaaggaagcgagcactcgtgaagtgctgggaatgcagcgggaagtgtat
ttgttgttttatgagctggaacggccgcgaatgccgtga

DBGET integrated database retrieval system