KEGG   Thielavia terrestris: THITE_2113335Help
Entry
THITE_2113335     CDS       T02228                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ttt  Thielavia terrestris
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    THITE_2113335
Enzymes [BR:ttt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     THITE_2113335
Glycosyltransferases [BR:ttt01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   THITE_2113335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(3723544..3723807,3723873..3725511,3725595..3726025)
Genome map
AA seq 777 aa AA seqDB search
MAATSTPQGTLRQRNVGAATTKKSKDGASDDVELDKLVKAAAAAKSPAGSERDYKVVFAV
ITALAFVTRFWGISHPNEVVFDEVHFGKFASYYLEKTYFFDVHPPFGKLLFAFMGWLVGY
DGHFHFENIGDSYIANKVPYVAFRSLPAILGALTVSVVYLIMWESGYSLPACIVAAGLVL
LDNAHIGQTRLILLDATLVFAMACSLFCYIKFYKLRHEPFSRKWWKWLILTGFALSCDIS
TKYVGLFAFITIGSAVLIDLWDLLDIKRPGGALSLAEFGKHFAARAFGLILVPFLFYLFW
FQVHLSILTRSGPGDDFMTPEFQETLSDNVMLANAVTIDYYDIITIKHKETKVYLHSHPD
RYPLRYDDGRVSSQGQQVTGYPFNDTNNHWQILPAGADDQQLGRHVMNHDLVRLRHVVTD
TILLSHDVASPYYPTNQEFTTVSIADAYGDRAADTLFEVRIEHGKPGQEFKSVSSHFKLI
HNPSKVAMWTHTTPLPEWGHRQQEINGNKQIAPSSNVWFVEDIPSLPADHKRREKPERQV
KTLPFLRKWFELQRSMFWHNNQLTASHPYASLPYQWPFLLRGVSFWTQNDTRQQIYFLGN
PVGWWIASSVLAIYAGIVLADQFSLRRGVDALDHRTRSRLYNSTGFFFLAWATHYFPFFV
MGRQLFLHHYLPAHLASTLVTGSLVEFIFSQDAAEHEAAYQAAKAGKKAAAPKRHLTARE
RFAGQSLLASWIATLVILALVAASWYFFLPLTYGYPGLSVEQVLRRKWLGYDLHFAK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggccgccacatcgacaccccagggcactttgcgccagcgcaacgttggcgccgcgacg
accaagaagtccaaggatggcgcctcggacgacgtcgagttggacaagctcgtcaaggcc
gccgccgcggccaaatcccccgccggctctgaacgggactacaaggttgtcttcgccgtc
atcacggctttggccttcgtcacccggttctgggggatcagccacccgaacgaggtcgtc
ttcgatgaagtccacttcggcaagttcgcctcgtactacctcgagaagacgtacttcttt
gatgtccaccctccgttcggcaagctgcttttcgctttcatgggctggctggtcggctat
gatggccatttccacttcgagaacatcggcgactcgtacatcgcgaacaaggttccctac
gtcgcgttccgttccctgcctgctatcctcggcgccctgaccgtctcggtggtgtacctg
atcatgtgggagtctgggtacagtcttcccgcctgcatcgtggctgccggcttggtcctt
ctagacaacgcccacatcggccagacgcgtctgatcctgctcgatgccaccctcgtcttt
gccatggcctgcagcttgttctgctacattaagttctacaagctgcggcacgagcccttc
tcgcggaagtggtggaagtggcttatcctgactggcttcgccctgtcgtgcgacatttcc
accaagtatgtcggcctgttcgccttcatcaccattggttctgccgtcctcatcgacctc
tgggacctgttggatatcaagaggcctggaggcgccctgagcctggccgagtttggcaag
catttcgccgccagggcgtttggcctgattctcgtgcccttcctcttttacctcttctgg
ttccaggtccacctctccatcctcacccgctccgggcccggagatgatttcatgaccccc
gagttccaggagacgcttagcgacaacgtcatgcttgcgaacgccgtcacgatcgactac
tacgacatcatcacgataaagcacaaggagaccaaggtgtacctccacagccacccggac
cgctaccccctgaggtacgacgacggccgtgtctctagccagggtcagcaggtcaccggc
tatcctttcaacgataccaacaaccactggcagatcctccctgctggtgcggatgaccaa
cagctcggccgccacgtcatgaaccacgacctcgtcaggctgcgtcacgtcgtcaccgac
accatcttgctgtctcacgatgtcgcttctccgtactaccccaccaaccaggagttcacc
acggtctcgattgcggatgcctacggcgaccgtgccgccgacaccctgttcgaggtgcgg
attgagcatggcaagcctggccaggagttcaagagcgtttccagccacttcaagctcatc
cacaaccccagcaaagtcgccatgtggactcacactacgccactcccggagtggggtcac
aggcagcaagagatcaacggaaacaagcagattgccccgagctccaacgtctggttcgtt
gaggacattccgtccctcccggccgaccacaagcgccgcgagaagcccgagaggcaggtc
aagacgctcccgttcctgcgaaagtggttcgagctgcagcggtccatgttctggcacaac
aaccagcttaccgccagccatccctatgcgtcgctgccttaccagtggccattcctgctc
cgcggcgtcagcttctggacgcagaacgacacccgccagcagatctacttccttggcaac
cccgttggctggtggattgcaagcagcgtgctggcaatctatgccggtatcgtcctggca
gaccaattctcgctgcgtcgcggcgttgacgctctggatcatcgcacgcgctcgcgcctg
tacaactcaacaggctttttcttcctggcctgggcaacccactacttccccttcttcgtg
atgggccgccagctcttcttgcaccactacctgcccgcacatttggcctcgaccctcgtg
acgggctccctggtcgaatttatcttcagccaggacgccgccgagcacgaggcggcctac
caggccgccaaggccggcaagaaggccgccgcacccaagcgccacttgaccgcccgcgag
cggtttgccggccagagcttgctggcgtcgtggattgccaccctggtcatcctcgccctg
gtcgccgccagctggtatttcttcttgccgctgacctacggctatcctggtttgtctgtg
gagcaggtcctgaggcggaagtggcttggctatgatctgcacttcgccaaatag

DBGET integrated database retrieval system