KEGG   Thielavia terrestris: THITE_2113741Help
Entry
THITE_2113741     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ttt  Thielavia terrestris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    THITE_2113741
Enzymes [BR:ttt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     THITE_2113741
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   THITE_2113741
  Exosomal proteins of colorectal cancer cells
   THITE_2113741
  Exosomal proteins of bladder cancer cells
   THITE_2113741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4322984..4323116,4323183..4323399,4323455..4324622)
Genome map
AA seq 505 aa AA seqDB search
MHKAQKFALGLLAAAAVATASDVVQLKKDTFDDFIKTNDLVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLVKVDCTEETDLCQQHGVEGYPTLKVFRGLDNVSPYKGQRKAAAITS
YMIKQSLPAVSEVTKDNLEEFKKADKVVLVAYVDASDKASSEVFTQVAEKLRDNYPFGSS
SDAALAEAEGVKAPAIVLYKDFDEGKAVFSEKFEVEAIEKFAKTGATPLIGEIGPETYSD
YMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDK
FPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEGPVTVV
VAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATA
NDVPDEIQGFPTIKLYPAGAKDQPVTYSGSRTVEDLIKFIAENGKYKAAISEDAEETSSA
TETTTETATKSEEAAKETATEHDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggcccagaagttcgcgctcggcctgcttgccgcggcggcagttgccacagct
tcggatgttgtccagctgaagaaggacaccttcgacgacttcatcaagacgaatgacctt
gttctcgccgaattcttcgcgccgtggtgcggtcactgcaaggctctcgcccccgagtac
gaggaggctgcgaccacactgaaggagaagaacatcaagctcgtcaaggtggactgcaca
gaggagacggacctctgccaacaacatggtgttgagggctacccgactctcaaggtcttc
cgcggccttgacaacgtctccccctacaagggccagcgcaaggctgctgctatcacctcg
tacatgatcaagcagtctctgcccgccgtgtccgaggtcacgaaggacaacctggaggag
ttcaagaaggccgacaaggtcgtccttgtcgcctacgtggatgcttccgacaaggcgtcc
agtgaggttttcacccaggtcgccgagaagctgcgcgacaactacccgttcggctccagc
agcgatgctgcgctggccgaggctgagggcgtcaaggctcccgctatcgtcctttacaag
gactttgatgagggcaaggcggtcttctccgagaagttcgaggtggaggcgatcgagaag
ttcgccaagacgggcgccaccccgctcattggcgagattggccccgagacctactccgac
tacatgtcggccggcatccctctggcctacattttcgccgaaacggccgaggagcggaag
gagctcagcgacaagctcaagccgatcgccgaggctcagcgcggcgtcattaactttggt
actattgacgccaaggcttttggtgcccacgccggcaacctgaacctgaagaccgacaag
ttccccgccttcgccatccaggaggtcgccaagaaccagaagttccccttcgatcaggag
aaggagatcaccttcgaggcgatcaaggctttcgtcgacgattttgtcgccggtaagatc
gagcccagcatcaagtcggagccgatccccgagaagcaggagggccccgtcaccgtcgtc
gttgccaagaactacaatgagatcgtcctggacgacaccaaggatgtgctgattgagttc
tacgccccgtggtgcggccactgcaaggccctggctcccaagtacgaggagctcggcgcc
ctgtatgccaagagcgagttcaaggaccgggtcgtcatcgccaaggttgatgccacggcc
aacgacgttcccgatgagatccagggattccccaccatcaagctgtacccggccggtgcc
aaggatcagcccgtcacctactctggctcgcgcactgtcgaggacctcatcaagttcatc
gccgagaacggcaagtacaaggccgccatctcggaggatgccgaggagacgtcgtctgca
accgagacgaccaccgagacggccaccaagtcggaggaggctgccaaggagacggcgacg
gagcacgacgagctctag

DBGET integrated database retrieval system