KEGG   Thielavia terrestris: THITE_2114131Help
Entry
THITE_2114131     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ttt  Thielavia terrestris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    THITE_2114131
Exosome [BR:ttt04147]
 Exosomal proteins
  Proteins found in most exosomes
   THITE_2114131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(4966408..4966761,4966823..4971052,4971123..4971494,4971604..4971693))
Genome map
AA seq 1681 aa AA seqDB search
MAPALPIKFQELLQLGSLGVNQTAITFNTCTLESDSFVCLRDKKDEASSPEVLIVDLKNA
NNVIRRPIKADSAIMHWSRQVIALKAQSRTLQIFDLEQKQKLKSTTMSEDVSFWKWTSER
TLGLVTESAIYHWDVFDPTQVAPVKIFERNINLQNNQIINYRTSADGKWMVVVGISQQQG
RVVGAMQLYSKDRGISQAIEGHAAAFGTIRLEGAPEDTKLFSFAVRTAVGAKLHIVEVDH
PETNPVFPKKAVDVFFPPEAANDFPVALQISQKYGIIYLITKYGFIHLYDLETATCIFMN
RISGETIFTACGDKESTGILGINRKGQVLFVSADENTIVPYVLESHGTELALKLASRAGL
PGADNLYQQRFEQLFANGSYQEAAKVAANSPRGFLRTPQTIERFKRLPQQPGQMSYILQY
FGMLLDKGSLNQHETIELAQPVLAQNRKQLLQKWLGENKLECSEQLGDMVRPHDMTLALA
IYLKANVPHKVVAAFAETGQFDKILPYCAQTDYHPDFVQLLQHIVRVNPEKGAEFATSLA
NHEGGSLVDLERVVDIFQSQGMVQQATAFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNDMFSYFDKARIASLCEQAGLLQKALDLFEDPAAVKRVIVNVAGAPNFNPDWLVE
YFGRLSVEQSIDCLDAMMKHNIRQNLQSVVQIATKYAELLGPQRLIDLFEKYKTAEGLYY
FLGSIVNVSEDPEVVFKYIEAATKMGQIREVERICRDNNVYNPEKVKNFLKEAKLAEMLP
LMVVCDRFNFVHDLVLYLYQHQQFKPIEIYVQQVNPSRTPGVIGGLLDVDCDESIIKNLL
ATVNPVSIPIDELVREVETRNRLKLLLPFLEATLAAGNQQQAVYNALAKIYIDSNNNPEK
FLKENDQYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELVNITNENAMYKAQARYLLERAD
RELWMFVLSENNLHRRSVIDQVISTAVPESTDPAKVSEAVSCFLNADLPAELIELLEKIV
LEPSPFSDNQNLQNLLMFTAAKADKARVMDYIHRLDNFSADEIAHVCIEVGLHEEAFEVY
KKIDNKEAAVNVLVEHIVSIDRAQAYAEEVDIPQVWSKVAKAQLDGLRVSDSIDSYIKAE
DPKNYEEVIEIAVAAGKNEELIKYLRMARKTLREPTIDTALAFCYARLDQLAELADFLRA
TNVANVEESGDKAYAEGLFEAAKIFYTSISNWAKLATTHVHLADHQAAVDCARKANNIKV
WKEVHEACVSKKEFRLAQICGLNLIVDAEQLQALVKQYERNGYFDELINLLEQGLGLERA
HMGMFTELGIALSKYHPERLMEHLKLFWSRMNLPKMIRACEEANLWPELIFCYYHYDEFD
NAALAVMERPENSWEHQQFKEIIVKVANLEIYYKAINFYLEQHPSLLTDLLQVLTPRIDV
NRVVRMFQKSDNLPLIKPFLLNVQSQNKRTVNDAINDLLIEEEDYKTLRDSVENYDNYDA
VDLAGRLEKHDLVFFRQIAANIYRKNKRWEKSINLSKQDKLWKDAIETAAISGKPEVVEE
LLRYFVDIGNRECYVGMLYACYDLIRPDLVLELSWRNGLTDFTMPYMINLLCQQTKELAA
LKADNEARKAKEKEQEKVEDNTPILGGKRLMITAGPTGAAPPQAPYMQTNGFASQPTGYG
F
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggccttgccgatcaagttccaggagctgctgcagctcggcagcctgggtgtc
aaccaaaccgccatcacattcaacacctgcacgctagaatcagattccttcgtctgcctt
cgagacaaaaaggacgaggcgtcgtctcccgaagtcctcatcgtcgacctcaagaatgcc
aacaatgtcatccgccggcccattaaggccgacagtgcaataatgcactggtcgcgccag
gtcattgcgctgaaagctcagtcacggacactgcagatctttgatctggagcagaagcaa
aagctcaagtccaccaccatgagcgaggatgtctcgttctggaagtggactagcgagaga
acgcttggcttggtcacagagagcgccatctatcactgggatgtctttgaccccacccaa
gtcgcgcccgtcaagatctttgagcgtaacatcaacctccagaacaaccagattatcaac
taccgaacaagcgccgacggcaagtggatggttgtggttggcatctcacagcagcaggga
cgcgttgttggtgccatgcagttgtattcgaaggatcgcggtatcagccaggcgatcgaa
ggccacgccgccgcgtttggcacgatccggttagaaggcgcgcctgaagacaccaagctc
ttttccttcgccgtccggacagccgtgggcgctaagctgcacatcgtcgaggtcgaccac
ccggagacgaatcccgtgttccccaagaaggcagtcgacgtcttcttcccgccggaagcc
gccaacgatttccccgttgccctgcagatctcgcagaagtacggcatcatctacctgatc
accaagtacggattcatccatctctacgatctcgagacggcaacatgcatcttcatgaac
cgcatctcgggcgagaccatcttcacggcctgtggcgacaaggaatcaaccggcatcctc
ggtatcaatcggaagggtcaggtcctcttcgttagcgccgacgagaacacgatcgtcccg
tacgtgctcgagagccacggcaccgagttagcgctgaagctggcctcgcgtgccggtctc
cccggcgccgacaacctctaccagcagcgcttcgagcagctctttgctaatggcagctac
caagaagccgccaaggttgcagccaattcgcctcgcgggttcctgcggacgccgcagacc
atagaacggttcaagcggctccctcagcagcccggacagatgtcctacatcctgcagtac
tttggcatgcttctcgacaaggggtcgctcaaccagcacgagaccattgagctcgcccaa
ccggtgctggcccagaaccggaagcagctgctgcaaaagtggcttggcgagaacaagctc
gagtgctctgagcaactcggcgatatggttcgcccccacgacatgaccttggcgctggcc
atctacctgaaggccaatgtccctcacaaggttgtcgccgccttcgcggaaaccggccag
ttcgacaagattctcccgtactgtgcccaaaccgactaccatcccgacttcgtccagctc
ctccagcacatcgtccgcgtcaacccggagaagggcgccgagttcgctacgtctctggcc
aaccatgaaggaggctccctggtcgacctcgagcgggtggtagacatcttccagtcccag
ggcatggttcagcaagctaccgcgttcctgcttgatgccctcaaggacaacaagcctgag
catggccatctccaaacccggctgctagagatgaacttggtcaacgcgccgcaggttgcc
gatgccatcctcggaaacgacatgttttcctacttcgacaaggctcgcattgcatccctt
tgcgagcaggcgggcctgttgcagaaggctctggatctgttcgaagaccctgcggccgta
aagcgcgtcattgttaacgttgccggggcgcccaattttaaccccgactggcttgtcgag
tacttcggccgcctctcggttgagcagtccatcgattgcctggacgccatgatgaagcac
aacatccgccaaaacctgcagtccgtggtccagatcgccacgaagtacgccgagctcctc
ggcccccagcgcctgatcgacctgttcgagaagtacaagactgccgaaggtctctactac
ttcctgggcagcatcgtcaacgtcagcgaggaccccgaggtcgtcttcaaatacatcgag
gccgccactaagatgggccagattcgcgaagtggagcgcatctgccgcgacaacaatgtc
tacaacccggagaaggtcaagaacttcctcaaggaagccaagctggccgagatgctgccg
ctgatggttgtctgcgaccgcttcaacttcgtgcatgacttggtgctctacctctaccag
caccagcagttcaagcccatcgagatctacgtgcagcaagtcaatccatccaggacaccc
ggtgtcattggtgggttgttggacgtcgactgcgacgagagcatcatcaagaacctgctc
gccaccgtcaaccccgtgtccatccccattgacgagctggtccgtgaggtcgagacgcgg
aaccgcctcaagctgctgcttccgttcctggaggccaccctggctgccggcaaccaacaa
caggccgtgtacaatgcgctggcaaagatctacatcgactccaacaacaacccggagaag
ttcttgaaggagaacgaccagtatgacacgctcacggtcggcaagtactgcgaaaagcgc
gaccccaacctggcctacatcgcctaccgcaagggccagaacgacctcgagctggtcaac
atcaccaacgagaacgccatgtacaaggcgcaagcacgctatctcctcgagcgagcagac
agggagctctggatgttcgtccttagcgagaacaacctccatcggcgttctgtgatcgac
caggtcatctcgaccgccgtgccggagtcgacggatcctgcaaaggtttccgaggccgtg
tcgtgcttcctgaatgccgatctcccggctgagcttatcgagctcctggagaagattgtc
ctggagccgtcgcctttcagcgacaaccagaacctccagaacctgctcatgttcaccgcc
gccaaggcagacaaggcccgtgtcatggactacatccaccggctcgacaacttctccgcg
gatgagatcgcccacgtctgtatcgaggttggcctgcacgaggaggcgttcgaggtctat
aagaagatcgacaacaaggaagcggcggtcaacgtcctggtcgagcacatcgtcagcatc
gatcgtgcgcaagcttatgccgaggaggtcgacattccgcaggtctggagcaaggtggcc
aaggctcagctggatggcctccgggtcagcgactcgatcgactcatacatcaaggctgag
gatcccaagaactatgaagaggtcatcgagatcgcggtcgcagcagggaagaatgaagaa
ctcatcaagtaccttcgcatggcccgcaagacgctccgcgagcccacaatcgacactgcc
ctcgccttctgctatgcgcgcctcgaccagctcgctgagctcgcagacttcctgcgggcg
accaacgttgccaacgttgaggagtcaggagacaaggcttatgctgagggtctcttcgag
gcggccaagatcttctacaccagcatttctaactgggccaagctggctaccacccacgtg
cacctcgctgatcaccaagccgcggtcgactgtgcgcgcaaggccaacaacatcaaggtc
tggaaggaggtgcacgaggcatgcgttagcaagaaggagttccgtctcgcccagatctgc
ggcctcaacctcatcgtcgatgccgagcaactccaggcgctcgtcaagcagtacgagcgc
aatggctactttgacgagctcatcaacctgctcgagcagggtctcggtctcgagcgcgcg
catatgggcatgttcaccgagcttggaatcgcgctctccaagtatcaccccgaacgcctg
atggagcatctcaagctcttctggagcaggatgaacctgcccaagatgatccgcgcgtgc
gaggaggcaaacttgtggcccgagctgatcttctgctactaccactacgacgaattcgac
aatgctgcgctcgccgtcatggagcggcccgagaattcgtgggaacaccagcagttcaag
gagatcatcgtcaaggtggccaacctcgagatctactacaaggccatcaacttctacctc
gagcagcacccgtccctgctcaccgatcttctgcaggtcttgacgccgcggatcgatgtc
aaccgggtggtccgcatgttccagaagtcggacaacttgccgctcatcaagccgttcctg
ctcaacgtgcagtcgcaaaacaagcgcactgtcaacgatgcgatcaacgacttgctcatc
gaggaggaggactacaagaccctccgcgactcggttgagaactacgacaactacgatgcc
gtcgatctcgccggccgccttgagaaacacgacctggtgttcttccgccagatcgctgcc
aacatctaccgcaagaacaagcggtgggagaagtcgatcaacttgtccaagcaggacaaa
ctgtggaaggatgccattgagaccgccgccatttccggcaagcccgaagtggtagaggag
ctcctccgatacttcgtggatatcggcaaccgggaatgctacgtcggtatgctgtatgcg
tgctacgatctgatccggccggacctcgtcttggagctgtcttggcgtaacggcctcacc
gacttcaccatgccctacatgatcaacctcctctgccagcagacaaaggagctggcagcg
ctgaaggcggacaacgaggcccgcaaggccaaggagaaggagcaggagaaggtcgaggac
aacacgcccatcctcggcggcaagcggctcatgatcacggcgggcccgaccggcgccgct
ccgccccaggctccctacatgcaaaccaatggatttgcgtcccagccgaccggttacggc
ttctag

DBGET integrated database retrieval system