KEGG   Thielavia terrestris: THITE_2114181Help
Entry
THITE_2114181     CDS       T02228                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ttt  Thielavia terrestris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ttt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(5077501..5077602,5077718..5082125,5082202..5082416))
Genome map
AA seq 1574 aa AA seqDB search
MVSNEVYLLPLNDDGSPQVAGGYISLAPKHNEPITVRFAIEGTSSICRQGSLWVNIPERG
VEFRRDRFREFKLVPDFNRTIEISIPIYEAGAYAFYTTYAELPALTCQLAEPSHDSETRT
KKTPWYYIDVAPRLTLDGQPLPLPALSVFSVISKFMGKYPQDWERHLRGISDRGYNMVHF
TPLQVRGVSNSPYSLYDQLGWDPVCFPEGEKDVEKMVQSLEKNHSLLSLTDIVLNHTANN
SQWLQEHPEAGYNLTTAPWLESAYLLDSKLLELGFKLEQLGLPTELKSLDDLDKIMAAIK
TEVIASIRLWEYYVIDVDRDADAALESWVIGKTIFPDGSIGDGGIEALCSATAEEHAEWL
MKHGLRGTDRLGERFRRRADPSVAAALLSALFGKHEAGKEGTVDQAAVRARIAAVLDIVN
VPFYREYDAELSDIMQQLFNRIKYVRLDEHGPKLGPINRENPLIETYFTRLPRNEVTARH
KDEDLVLVNNGWVWGGNALIDNAGPESRVYLRREVIVWGDCTKLRYGNGPKDSPWLWDHM
TKYARMLAKYFHGFRIDNCHSTPLHVAEHILDEARRVRPNLYVVAELFTGSEDMDYVFVK
RLGLSSLIREAMQAWSTGELSRLVHRHGGRPIGNFEVDEITSTEVRSPTLENGENAENGY
KYTRETIRRIKPVPIQALFMDCTHDNEVPAQKRDARDTLPNAALVSMCATAIGSVMGYDE
IYPRLVDLVRETRLYESEASRFPVTVGEGKGGISGVKKLLNQIHTLMGMDGYDETHIHHE
QEYVTVHRVHPGSRKGYFLIAHTAFPGYGNGNGAFNPVRLTGTKAKHLGSWMLEVDASKE
AVEEVLSDRRHLRGLPSRLIAVPGIRMEVKGDDTIITVRDRFPPGSIALFETWIPAAEHS
SGLDTFVTSGAKAAMEELELVDLNYLLYKCEPEERDASDGRDGVYDIPGHGKLVYAGLQG
WWSVLKDIIEDNNLAHPLCQNLREGQWALDYIVGRLERASQQPLYVRLSKPAAWLRERFD
AIRSIPSFLLPRYFGLVLRTAYMAAIERGISLMSTNIRNGQWFLQSLAMVSVQQTGLVKS
ASLYPNRLVPSLAAGLPHFAVEWARCWGRDVFISLRGLYLGTGRFEEAKEHIRAFASVLK
HGMIPNLLGSGNTPRYNARDSVWFFLQSIQDYTRIAPDGLSLLDEKVKRRFLPYDDTWFP
ADDPRAYSKESTIREIIQEVFQRHAEGMKFREANAGPGLDMQMKDEGFNQEIKVDWSNGF
VFGGNQHNCGTWMDKMGESERAGSKGVPGTPRDGAAVEITGLLYSALNWVATLHEEGKYE
QSGVRKADGSEITFRAWADLIKDNFERCYFIPLSAASDSQYDVNPAVINRRGIYKDLYRS
GKEYEDYQLRPNFPIAMTVAPALFDPSHAMHALCVADAVLRGPSGMATLDPADLNYRPYY
RNSEDSDDFATSKGRNYHQGPEWLWPTGFFLRALLKFDLLRRRGATDGDGEGAGVGARES
RTEAFQQVTRRLKACKEMMQWSAWAGLAELTQKDGEECPDSSPTQAWSAGCLIDLYMDAA
EEQAKLEAQELPLR
NT seq 4725 nt NT seq  +upstreamnt  +downstreamnt
atggtttccaacgaggtctacctgctgccgctcaacgacgatggctcgccacaggtggcc
ggcgggtacatctcccttgctcccaagcacaatgagcccataaccgttcgtttcgccatc
gagggcacgtcgagcatctgccgtcagggcagcctgtgggtcaacatccccgagcgaggc
gttgagttccgccgcgacaggtttcgggagttcaagctcgttccggacttcaatcgcacg
attgagatatccatcccgatctacgaagcgggtgcctacgccttctataccacctacgcc
gagctgccggccctcacatgccaattggccgaacccagccacgattccgaaacgaggacc
aagaaaacgccatggtactatatagacgtggccccccgcctgacgctggacgggcagccg
ctgcctctgccggccttgtccgtgttctccgtcatcagcaagttcatgggcaagtacccg
caggactgggaacgccacctcaggggcatcagtgaccgcggctacaacatggtgcacttt
actccacttcaagtcaggggcgtttccaactcgccctacagcctgtacgaccagctcggg
tgggaccccgtgtgtttccccgagggcgagaaagacgtcgagaagatggtgcagagctta
gagaagaaccattcgttgctcagcttgacagatattgtcctcaaccacaccgccaacaac
agccagtggctgcaggagcatccggaggccggttacaacctgaccacagccccgtggctc
gagtccgcctatctgctcgactcgaagctgcttgagctcggcttcaagctggaacaactc
ggacttccgactgagctcaagtcgctcgacgacctcgacaagatcatggccgccatcaag
accgaggtcatcgccagcatccgcctttgggagtattatgtcatcgatgttgaccgagat
gcggacgcggcgctcgagtcatgggtcattggcaagacgatattccccgacggctccatt
ggcgacggcggtattgaggcgctctgctccgcaacggcggaagagcatgcagagtggctc
atgaaacacggcctcaggggcactgatcgtcttggcgagcgcttccggaggagagctgac
cccagcgtggctgccgccctcttgtcagccctgttcgggaaacacgaggccggtaaggag
ggcaccgttgaccaagccgccgttcgcgccaggatagcggcggtgctcgacattgtcaac
gtgccgttttaccgggaatacgacgcggaattgtccgacatcatgcagcagctcttcaac
cgcatcaaatacgtccggctcgatgagcatgggccgaagctgggccccatcaaccgcgag
aaccctctgatcgaaacatatttcacccgcctcccacgcaacgaagtgactgcgaggcac
aaagatgaagacttggtgcttgtgaacaacggatgggtttggggtggaaatgccctaatt
gacaatgcgggtcccgagtcccgagtctacctccgtcgcgaggttattgtctggggtgac
tgcaccaagctacgttacgggaacggccctaaggacagcccgtggctctgggaccacatg
accaagtatgcccgcatgcttgccaagtactttcacggcttccgaatcgacaactgccat
tcgactccccttcacgtcgccgagcacattctcgatgaggcccgccgtgtccgcccgaac
ctgtatgttgtcgccgagctcttcactggctccgaagatatggactacgtcttcgtgaag
aggcttggcctgagctcgctcatccgcgaggcgatgcaggcttggagcaccggcgagctg
agccgccttgtccatcgccacggcggccgccccatcggaaacttcgaagtggatgaaatc
acaagcaccgaggtgcgcagtccaaccttggaaaatggagagaatgcggaaaacgggtac
aagtacacacgcgagaccatccgtcgcatcaaacctgtccctatccaagcactgttcatg
gattgcacccacgacaatgaagtgccggcgcagaagcgggacgcccgtgacaccctgccc
aacgcagccctggtaagcatgtgtgccacggcaatcgggagcgtcatgggatacgacgaa
atttatcccagactggtggacctagtgagagaaactcgcctctacgagtctgaggcgtcc
aggtttcccgtgacggtaggagaaggcaagggtggcatttccggggtcaagaagctgctc
aaccagatccacacgctgatgggcatggacggctacgacgagacgcacattcaccacgaa
caagagtacgtaaccgtgcaccgggtgcaccctggctcgcggaaagggtacttcctaatc
gcgcacacggccttccccggctatggcaacgggaatggcgccttcaatcccgtccgcctg
actgggaccaaggccaagcatctaggcagctggatgctggaggttgacgcgagcaaggag
gctgtggaggaagtgctgagcgacaggcggcacttgcgcggccttccgagtcggctcatt
gccgtgcccgggatccggatggaggtcaagggagacgacaccatcatcactgtccgagac
aggttccctcccggcagcattgccttgttcgagacttggatccccgcggcggagcactcg
agcggcctcgatacctttgtcacgtccggcgccaaggccgcgatggaggagctcgagctg
gtcgacttgaattatctgctgtacaagtgtgagccggaggagcgagatgccagcgatggc
cgggatggtgtatacgatattccgggccacggaaagcttgtgtacgctggcttgcaaggt
tggtggagcgtcctcaaggacatcatcgaggacaacaacctcgcacatcccctctgtcag
aatctccgcgagggccagtgggcgctcgactacatcgtgggcaggctggagcgggcctcg
cagcagccgctgtacgtccggctctccaagcccgccgcttggctaagagagcgtttcgac
gccatccgcagcatccccagcttcctgcttccccggtacttcggcttggtcctgcggacc
gcttacatggcggccatcgagaggggtatctccctcatgagtaccaacatccgtaacgga
cagtggttcctgcaaagcctggccatggtcagtgtccaacaaaccggccttgtcaagtct
gcgtccctctaccccaaccgcctggtcccgtcgcttgcggcgggcctcccacattttgcg
gtcgagtgggcgcgttgctggggcagagatgtctttatctctcttcgaggtctatacctt
ggtacgggccgcttcgaagaggcgaaggagcacatccgcgcgtttgcaagcgtcctcaag
cacgggatgatcccaaatcttcttggaagcggcaacaccccgcggtacaacgctcgcgac
tcggtctggttcttcttacagtccatccaggattacacccggatagcacccgacggcctg
tcgctgctagacgagaaggtcaagaggcgatttttgccatacgatgacacctggttcccc
gcggatgaccccagagcgtatagcaaggagagcacgatccgtgagatcatccaggaggtc
ttccagcgccacgcagaaggcatgaagtttcgggaggcgaatgccgggcccggcttggac
atgcagatgaaggatgagggtttcaaccaggagatcaaggttgactggagcaacggcttc
gtctttggcggaaaccagcacaactgcggcacctggatggacaagatgggcgagagcgag
cgcgcaggctccaagggcgtccccggaacgccgcgtgacggcgccgctgtcgagatcacc
ggtctgctgtacagcgctctgaactgggtggccaccctgcatgaagagggcaagtacgag
caatccggtgtccgcaaggccgacggctccgagatcacctttcgagcctgggccgacctc
atcaaggataacttcgagcggtgctacttcatcccgctctccgccgcgtccgactcgcag
tacgacgtcaacccggcagtgatcaaccgccgcggcatctacaaagacctgtaccgctcc
ggcaaggagtacgaggactaccagctgcggcccaacttccccatcgccatgacggtagcc
ccggccctcttcgacccctcccacgcgatgcacgcgctctgcgtcgccgacgccgtcctg
cgcgggccatccggcatggccacgctcgacccggccgacctcaactaccggccgtactac
cgcaacagcgaggacagcgacgacttcgccaccagcaagggccgcaactaccaccaggga
ccggagtggctgtggcccacgggcttcttcctgcgcgcgctgctcaagtttgatctgctg
cgccgccgcggggccacggacggggatggggagggggccggggtcggcgcgcgggagagc
cggaccgaggcgttccagcaggtcaccaggcggctcaaggcgtgcaaggagatgatgcag
tggagcgcgtgggcggggctcgcggagctgacgcagaaggatggggaggagtgtccggat
tcgagtcctacccaggcgtggtcggctggttgtctgatcgatttgtacatggacgcggcg
gaggagcaggccaagctggaggctcaggagctgcctctccgatga

DBGET integrated database retrieval system