KEGG   Thielavia terrestris: THITE_2114637Help
Entry
THITE_2114637     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ttt  Thielavia terrestris
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THITE_2114637
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     THITE_2114637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(5975081..5975090,5975197..5975413,5975506..5975803,5975865..5975930)
Genome map
AA seq 196 aa AA seqDB search
MAPVRDPRPIVISGPSGVGKGTLYKLLFQRHPDTFTLSVSHTTRSPRPGEKDGVDYHFVT
KEAFLELKAKDGFVENAQFGDNLYGTSKATIEEQTAKGKTVVLDIEVEGVKQIQASGFPA
RYVFIAPPSEEELEKRLRGRGTETEASIQKRLDRAKVELEYAKVPGVHDKIIVNDDLETA
YKELEEFVFAAPPAST
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgttcgcgacccccgtccaatcgttatttcaggcccgtcgggcgtcggcaag
ggaaccctctacaagctgctcttccagcgacaccccgacaccttcaccctctccgtctcg
catacgactcgtagtccgcggccgggcgagaaggatggcgtggactaccacttcgtcacc
aaggaggccttcctggagctgaaggccaaggacggtttcgtcgaaaatgcgcaattcggc
gacaacctctacggcacgtccaaagccacgatcgaggagcagacggccaagggtaagacg
gtcgtgctggacatcgaggtcgagggcgtgaagcagatccaggcgtcgggcttcccggcc
cggtacgtcttcatcgccccgccgtccgaggaagagctggagaaacgcctccggggccgc
gggaccgagacggaggcctcgatccagaagcggctagaccgcgccaaggtcgaactggag
tacgccaaggttcccggcgtgcatgacaagatcatcgtgaacgatgatctggagacggcg
tacaaggagctcgaggagttcgtcttcgctgcgccaccggcgagcacgtag

DBGET integrated database retrieval system