KEGG   Thielavia terrestris: THITE_2115296Help
Entry
THITE_2115296     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     THITE_2115296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:7125405..7127246
Genome map
AA seq 613 aa AA seqDB search
MAELDTLDVIVLAAILIGTVVYFTKGKLWGVTKDPYASSFANANGAKAGKTRNIIEKMEE
SGKNCIIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEDYDYDNLDALPSDKVVMFV
LATYGEGEPTDNAVDFYEFITSESPSFSLDNDPPLGNLNYVAFGLGNNTYEHYNSMVRNV
NKALQKLGAHRIGEAGEGDDGAGTMEEDFLAWKDPMWKALAEKMGLEEREAVYEPIFGIV
EKDDLTPDAPEVYLGEPNKMHLDGTPKGPFNAHNPYIAPIQKSYELFNVKDRNCLHMEVD
ISGSNLSYQTGDHIAVWPTNAGEEVDRFLDIFDLTDKRHRVIGVKALEPTAKVPFPTPTT
FDAIVRYHMEICAPVSRQFIATLAAFAPDEESKAEMTKLGSDKDYFHSKVNAQFLNIARL
LAIVSKGKKWTNVPFSALIEGLNKLQPRYYSISSSSLEQPKLISITAVVESQELPGREDP
FRGVATNYLLALKEKQNGDPNPTPYGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSDPTK
PIIMVGPGTGVAPFRGFVRERRKMVENGQAVGKTILFFGCRKSTEDFMYEKEWEVRGLSS
TFFALPSRGSLLC
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacttgacacgttggacgttatcgtcctggccgccatcctcattgggacggtg
gtctatttcaccaagggcaaactctggggcgttaccaaggacccgtacgcgagctcgttt
gcgaatgcgaatggcgccaaggcgggcaagacccggaacatcatcgagaagatggaggag
tccgggaagaactgcatcatcttctacggttcgcagaccggcaccgccgaggattacgcc
tcgcggctggccaaggaaggcaagagccgcttcggactggagaccatggtcgccgacctc
gaggactacgattacgacaacctcgacgcccttcccagcgacaaggtcgtcatgttcgtg
ctggcaacctacggcgaaggcgagccgacagacaatgcggtcgacttctacgagttcatc
accagcgagagcccgtctttctctctcgacaacgaccctcccctcggaaacctcaactac
gtggccttcgggctgggcaacaacacgtacgagcactacaactccatggtccgcaatgtc
aacaaggccctgcagaagctcggcgcccaccgcatcggagaggctggcgagggcgacgat
ggcgctggcaccatggaggaggacttcctggcttggaaggaccccatgtggaaggctctg
gcggaaaagatgggcttggaggagcgcgaggctgtctacgagcccatctttggcattgtt
gagaaggacgatctgacccccgatgcgcccgaggtctacctcggcgagcccaacaagatg
cacctcgacggcacccctaagggtcccttcaacgcgcacaacccttacatcgcgccgatt
cagaagtcctatgagctcttcaatgtcaaggatcgcaactgcctgcacatggaggtcgac
atcagcggctccaacctgagctatcagaccggcgaccacatcgctgtctggcctaccaac
gccggcgaggaggtcgaccgcttcttggatatcttcgatctcaccgacaagcgtcaccgt
gtcatcggcgtcaaggccctggaacccaccgccaaagtgccgttcccgaccccgaccacc
ttcgacgccatcgttcgctaccacatggagatttgcgctcccgtttcgcgccagtttatt
gctacgcttgcggcattcgcccccgacgaggaatccaaggccgagatgaccaagctcggt
agcgacaaggattacttccactccaaagtcaacgctcagtttctcaacatcgcgcgtctc
ctagccatcgtcagcaagggcaagaagtggactaacgttccgttctcggctctcatcgaa
ggcctcaacaagttgcagcctcgttactactcgatttcttcgtcctccttggaacagccc
aagctcatctccatcaccgcggtggtcgagtcgcaggaactgcccggtcgtgaagaccca
ttcaggggcgtcgcgacaaactatctcttggctctcaaggaaaagcagaacggcgatccc
aaccccacgccttacggtctgacctacgagatcacgggtcctcgtaacaagtacgacggc
atccacgtcccggtccacgtgcgccactcgaatttcaaacttccgtcggatcccacgaag
cccatcatcatggtaggcccgggaaccggcgtggcccccttccgaggattcgtccgcgag
aggagaaagatggtcgagaacggccaggctgtcgggaagacgatcctctttttcggttgc
cggaaatcgaccgaggacttcatgtacgagaaagagtgggaggtgcgtggtctttcctcg
acgtttttcgctttgccttcaagaggttctcttctttgctga

DBGET integrated database retrieval system