KEGG   Thielavia terrestris: THITE_2115457Help
Entry
THITE_2115457     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
ttt  Thielavia terrestris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    THITE_2115457
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THITE_2115457
Enzymes [BR:ttt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     THITE_2115457
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     THITE_2115457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(7423928..7423981,7424132..7427710,7427812..7430270,7430336..7430972))
Genome map
AA seq 2242 aa AA seqDB search
MTVAAAALYRPATARVAHAESQGLVTLELEDGSAYQGYSFGAPKSIAGELVFQTGMVGYP
EAITDPSYRGQILVITFPLVGNYGVPPRDALDELLGDLPAHFESSQIHIAGLVTATYAGE
DYSHFLATSSLGTWLKEQGIPAMYGVDTRALTKRISEKGSMLGRMLLEKQDLVDGVNGDA
EGLALPGKMGDWRPFFESIDWVNPNEKNLVAEVSIKAPKLYRPPQASALKHPSGRPLRIL
CLDVGMKYNQLRCFLKRGVEVLVCPWDYDFRAETYDGLFISNGPGDPAIVETTVNRVAAA
LSENRTPIFGICLGHQLLARAAGAQTIKLKFGNRGHNIPCTSMVTGKCHITSQNHGYAVD
AATLPTGWQELFVNANDGSNEGIMHVDRPHFSVQFHPESTPGPRDTEFLFDVFIQTVLGC
AADSTLLQKAVQFPGGTVEENNRLHPRVSVKKVLVLGSGGLSIGQAGEFDYSGSQAIKAL
KEEGIYTVLINPNIATIQTSKGLADKVYFLPVNAEFVRKVIVYEKPDAIYCTFGGQTALQ
VGIQLRDEFEKLGVKVLGTPIDTIITTEDRELFARSMDSIGEKCAKSASACNVDEALRVV
KDIGFPVIVRAAYALGGLGSGFANNEAELLDLCNKAFAASPQVLIERSMKGWKEIEYEVV
RDCQDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGEC
NIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAFIAAKLGLGIPLKEIKNSVTKV
TCACFEPSLDYVVVKMPRWDLKKFTRVSTQLGSSMKSVGEVMSIGRTFEEAIQKAIRAID
YRNLGFNETPALMSIDDELQTPSDQRLFAIANAMAAGYSVERIWDLTKIDKWFLDRLKGL
NDFAEKMKELKAAGGALRPGMLLHAKQLGFCDRQIAKFWGSTELAVRGMRLEAGITPFVK
QVDTVAAEFPAYTNYLYLTYNASEHDVSFDDHGVMVLGSGVYRIGSSVEFDWCSVRAIRT
LRETGHKTIMVNVNPETVSTDYDEADKLYFDNLDLETVLDIYEAESSSGVLGAMGGQTPN
NIALPLLRAGVRVLGTSPEMIDTAENRYKFSRMLDRIGVDQPTWKELTSFEDARAFCQKV
SYPVLVRPSYVLSGAAMNTVYSEGDLQSYLQQAADVSPEHPVVITKYIENAKEIEMDAVA
KDGKVVCHFISEHVENAGVHSGDATLILPPQDLEQTTIQRIEDATRKIGDALNVTGPFNI
QFIAKDNDIKVIECNVRASRSFPFVSKVMGVDLIEMATKAIMNIPFEEYPKIDRPTNAVG
VKVPQFSFARLSGADPVLGVEMASTGEVASFGADKYEAYLKALLSTGFKIPKNNILLSIG
SYKDKEEMLPSVKKLQEMGYKLFATAGTADFLGSHGVQVQYLEVLGKEEDDQKSEYSLTQ
HLANNMIDLYINLPSNNKYRRPANYVSKGYRTRRMAVDYQIPLVTNVKNAKILVEALARH
FELDVGLRDYQTSHRAIQLPGLVNIAAFVPGLVSRDSDDLERVTKASAASGFSMIRVMPV
AKDGSISDVKSLKIAQQNGKRGAYCDFNLSITATSDNAHQISHAAGEVGSLFIPFNHLSD
NISKVAAVQAHFEAWPTHKPIITDARTTDLASILLLASLHNRRIHVTAVTIKEDIKLIAL
GKQKGMKVTCDVCIYSLYLSQKDYPGCQFLPTAEDQAALWEHLETIDVFSIGSLPYQLAH
FLKQPTGVAVGIADALPLLLTSVADGKLTIEDVKTRLHDNPREIFELHDQVGAYLEAEID
RPYTLKVADAWSPFAGKVMKAAVQRVTFQDQVVCLDGSMLAVPPRGNDMSTHGAAPPTVA
MTSPAVRPIHHPMSPVVDERRQSLAGVRSVSGRSKAAESAAAALAAAARVPVVEDVTLPL
TTQPTISPLQEMLSAPSSFKKSHVLSVTQYTRADLHLLFNIAQEMRLGVQREGVLDILKG
RVLCTLFYEPSTRTSASFDAAMQRLGGRTIAVTTSTSSVQKGETLQDTLRTLACYGDAVV
LRHPDEKCVDIAKKYSPVPVINGGNGSKEHPTQAFLDLFTIREELGTMQGLTITFVGDLL
YGRPVHSLVALLRHYQVKVQLVAPQALALPASVRQQLVDAGQLIGESETLTPAILGRTDV
LYCTRIQRERFPSLAAYEAVKHAYRVDYGTLKHAKSSMIVLHPLPRNEEVAEEVDFDQRA
AYFRQMRYGLYCRMALLALVMS
NT seq 6729 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcggcggctgcgctctaccggccggccacggcgcgcgtcgcccacgccgag
tcccaggggctggtcacccttgagctcgaggacggctcggcctaccagggttacagcttc
ggcgcgcccaagagcatcgctggcgagctagtcttccagaccggcatggtggggtacccg
gaggccatcaccgacccctcatatcgcggccagatcctcgtcatcaccttcccgctcgtc
ggcaactacggcgtcccgccaagggacgcgctcgatgagctcctcggcgacctgcccgcc
cacttcgagtcgtcgcaaatccacatcgccggcctcgtgacggccacctacgcgggcgag
gactactcacacttcctcgccacttcgtccctcggaacatggctgaaggagcagggcatc
ccagccatgtatggcgtcgacacccgcgcactgacgaagcgcatcagcgagaaaggcagc
atgcttggccgcatgctactggagaaacaggacctggtcgacggtgtcaatggcgacgct
gagggtttggcgctgcctggcaagatgggcgactggaggccattcttcgagtcgatcgac
tgggtcaaccccaacgagaagaaccttgtagcagaggtttccatcaaggcgccgaagctg
taccggccgccccaggcctccgccctgaagcacccatcgggacgcccgctccgcattcta
tgtctcgacgttggtatgaaatacaaccagctgaggtgcttcctcaagcgcggcgtcgaa
gtcctggtctgcccctgggactacgacttccgcgccgagacctacgacggcttgttcatc
tccaacgggcccggcgacccggccatcgtggagacgacggtcaaccgtgtcgccgcagcc
ctgtcggagaaccggacgccgatcttcggcatctgcctaggccaccagctgctcgctcgc
gccgcgggagcccagaccatcaagctcaaattcggtaaccgtggccacaacatcccgtgc
accagcatggtgacgggcaagtgtcacatcacttctcagaaccacggctacgccgtcgac
gccgccaccctgcccaccgggtggcaggagctgttcgtcaacgccaacgacggcagcaac
gagggtatcatgcacgtcgatcggccgcacttcagcgtccagttccacccggagagcacc
cccggcccgcgagacaccgagttcctctttgacgtcttcatccagaccgtcttggggtgc
gctgctgacagcaccctgctgcagaaagccgtccagttccccggcggcaccgtcgaggag
aacaaccggctgcacccccgcgtttccgtcaagaaggtcctcgttctcggcagcggtggt
ctcagcattggccaggccggcgagttcgactactccggcagtcaggcgatcaaggcgctg
aaggaagagggcatctacaccgtcctcatcaaccccaacatcgccaccatccagacctcc
aagggcctcgccgacaaggtttacttcctccccgtcaacgccgagttcgtgcgcaaagtc
atcgtctacgaaaagccggatgccatctactgcacctttggcggccagaccgccctgcag
gtgggcatccagctcagggacgaatttgagaaactcggtgtcaaggtcctcggcacgccg
atcgacaccatcatcaccaccgaggaccgcgagctcttcgctcgcagcatggactcgata
ggcgaaaagtgcgctaagtcggcctcggcctgcaacgttgacgaggccctgcgggtcgtg
aaggacatcggcttccccgtcatcgttcgtgccgcgtatgcccttggtggtctcggcagc
ggcttcgccaacaacgaagccgagctgctagatctgtgcaacaaggcctttgccgccagc
ccccaggttctgatcgagcgcagcatgaagggctggaaagagatcgagtacgaggtggtc
agggattgccaggacaactgcatcaccgtgtgcaacatggagaatttcgatcccctcggc
atccacactggcgattcgatcgtcgtcgccccctcccagacgctctcggacgaggactac
aacatgctccgtaccacggccgtcaacgtcatccgccacttgggcgtcgtcggcgagtgc
aacatccagtacgccctgaaccccttctcgaaggagtactgcatcatcgaggtcaacgcc
agactgtcccggtcctccgccttggcctccaaggccaccggctaccctctcgcattcatc
gctgccaagctcggtctcggaattcccctgaaggagatcaagaactccgtcaccaaggtg
acgtgcgcctgcttcgagccctcgctcgactacgtcgtcgtcaagatgccccgctgggac
ctgaagaagttcacccgcgtctccacccagcttgggtcttccatgaagagcgtcggcgag
gttatgagcattggcaggaccttcgaggaggcgattcagaaggccatccgggccatcgac
taccgcaacctcggcttcaacgagacaccggctctaatgtcaatcgacgacgagctccag
accccgtcggaccagcgcctttttgccattgccaacgccatggccgctggctattcggtc
gagcggatctgggatctgaccaaaatcgacaagtggttcctcgaccggttgaagggcctg
aacgatttcgccgagaagatgaaggagctcaaggccgccggcggcgccctgcggcctggc
atgctcctccacgccaagcagctcgggttctgcgaccgccagatcgccaagttctggggc
tctaccgagctcgccgtgcgcggcatgcgtctcgaagccggcatcacccccttcgtgaag
caggtcgacaccgtcgccgccgagttccccgcttacaccaactacctgtacctcacctac
aacgccagtgagcacgacgtctccttcgacgaccacggcgtcatggtgctcggctccggc
gtgtaccgcatcggctcctccgtcgagttcgactggtgctccgtccgggcgatccgcacg
cttcgcgagaccggccacaagaccatcatggtgaatgtaaaccccgagaccgtgagcacc
gattacgacgaagccgacaagctctacttcgacaacctcgacctcgagacggtgctggac
atctacgaggctgagtcttctagcggagtcctgggagccatgggcggacagacgcccaac
aacatcgctcttccgctgctgcgtgctggcgttcgcgttctgggcacttcgcccgagatg
atcgacacggccgagaaccggtacaagttctcgcgcatgttggatcggattggcgttgac
cagccgacctggaaggagctaacgagcttcgaggacgccagggccttctgccagaaggtc
tcgtatcccgtgctggtgcggccgtcgtacgtgctgtcgggtgccgccatgaacacggtc
tactcggagggcgacctgcagagttacctgcaacaagccgccgacgtgtctcccgagcat
cccgtcgtcattaccaagtacatcgagaatgccaaggagattgagatggacgccgtggcc
aaggacggcaaggtcgtgtgccacttcatttcggagcacgtcgagaacgccggtgtccac
tcgggtgatgccacgctcatcttgccaccgcaggacttggagcagacgaccatccagcgc
atcgaggacgcgacccgcaagatcggcgacgcgcttaacgtcaccggtcccttcaacatc
cagttcatcgccaaggacaacgacatcaaggtgatcgagtgcaatgtgcgcgcctcgcga
tccttcccgttcgtttccaaggtcatgggtgtggacctgatcgagatggctaccaaggcg
atcatgaacattcctttcgaggaatatccgaagatcgaccgccctaccaacgccgtcggc
gtcaaagtgccccagttcagcttcgcgcgtctgtctggcgccgaccccgtactcggcgtc
gagatggcgtcgacgggcgaggtcgcttcgttcggcgccgacaagtacgaggcgtacctc
aaggctctgctgtcgacgggcttcaagattcccaagaacaacatcctgctctccatcggc
tcctacaaggacaaggaggagatgctgccctcggtcaagaagctgcaggagatgggctac
aagctcttcgcgacggccggaaccgccgacttcctcggcagccacggcgtgcaggtgcag
tacctcgaggtgctcggcaaggaagaggatgaccagaagtccgagtactcgctcacgcag
cacctggccaataacatgatcgacctgtatatcaacctgccctccaacaacaagtacagg
cgcccggccaactacgtgagcaagggttaccggactcgccgcatggccgtcgattaccag
atccctctcgtcaccaacgtcaagaacgccaagattctggtggaagcccttgccaggcac
ttcgagctcgacgtcggcttgcgcgattaccagacgagccaccgcgcgatccagctgcca
ggcttggtcaatattgccgcgttcgtgcccggtctcgtctccagagatagcgacgatctc
gagcgcgtgaccaaggcttcagccgctagcggcttcagcatgatccgcgtcatgccggtt
gccaaggacggctccatctcggatgtgaagtcgctcaagatcgcccagcagaacggcaag
cgaggcgcgtattgcgacttcaacctatccatcacggccacctcggacaacgcccaccag
atcagccatgccgccggcgaggtcggatcgctgttcatcccgttcaatcacctctcggac
aacatcagcaaggtcgctgccgtgcaggcgcacttcgaggcttggccaacgcacaagccc
atcattacggacgcgaggaccacggacctggcctcgatcctcctgcttgccagcctgcac
aaccgccggatccacgtcacggcggtgacgatcaaggaggacatcaaactcatcgcactg
ggcaagcagaaggggatgaaggttacctgcgatgtctgcatctactcgctgtacctgtcg
cagaaggactaccccggctgccagttcctaccgacggccgaggaccaggccgccctgtgg
gagcacctggagacgatcgatgtcttctccatcggcagcctgccctaccagctcgcccac
ttcctgaagcagccgaccggtgtggccgttggcattgccgatgccctgccgctcctcctc
acttcggtcgccgacggcaagctgacgattgaggatgtcaagacccgtctgcacgacaac
ccgagggagatcttcgagctgcatgaccaggtcggtgcgtacctcgaggcggagattgac
cgcccatacacgctgaaggtcgccgacgcttggtcgccttttgcgggcaaggtcatgaag
gccgcggttcagcgggtaaccttccaggaccaggtcgtctgcctcgatggctccatgctc
gcggttccgcccaggggcaacgacatgtccacgcacggggcagcgcctccgacggttgcc
atgacgtcgccggcagtccgacccatccaccaccccatgtcgccggtggtggatgagcgt
cgccagagcctggccggcgttcggtcggtgtctggcaggtcgaaggccgctgagagcgcc
gcagcggcccttgccgccgcggctcgggtgcctgtcgtggaggatgtcactcttccgttg
accacgcagccaaccatctcaccgctgcaggagatgctttctgcgccgtcctccttcaag
aagtctcacgtgctgtccgtcacgcagtacacgcgtgcggacctgcacctgctcttcaac
attgcgcaggagatgcgcctcggcgtccagagggagggtgtcctcgacatcctcaagggc
cgcgtgctgtgcaccctgttctacgagccgtcgaccaggacttcggcctcgtttgatgcg
gccatgcagcgcctaggcggcaggaccatcgccgtcacgacatcgacctcgtccgtccag
aagggcgagacgctccaggacacgctgcggacgctcgcctgctacggcgacgcggtggtg
ctccgccacccggacgagaagtgcgtcgacatcgccaagaagtacagccccgtccccgtc
atcaacggcggcaacggcagcaaggagcacccgacgcaggccttcctcgacctcttcacg
atccgcgaggagctcggaacgatgcagggcctgaccatcaccttcgtgggcgacctgctg
tacgggcggccggtgcactcgctcgtggcgctgctgcgtcactaccaggtcaaggtgcag
ctggtggcgccgcaggcgctcgcgcttcccgcctcggtgcgccagcagctcgtcgacgcc
ggccagctcatcggcgagtcggagacgctgacgcccgccatcctcggccgcaccgacgtg
ctgtactgcacgcgcatccagcgcgagcgcttcccctccctcgccgcctacgaggccgtc
aagcacgcgtaccgcgtcgactacggcaccctcaagcacgccaagagctccatgatcgtg
ctgcacccgctgccgcgcaacgaggaggtcgccgaggaggtcgattttgaccagcgcgcc
gcctatttcagacagatgagatatggtctctactgtcgcatggctctgcttgcgctggtc
atgtcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system