KEGG   Thielavia terrestris: THITE_2115513Help
Entry
THITE_2115513     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ttt  Thielavia terrestris
Brite
Exosome [BR:ttt04147]
 Exosomal proteins
  Proteins found in most exosomes
   THITE_2115513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(7515426..7515560,7515642..7515800,7515913..7515997,7516079..7516094,7516177..7516189))
Genome map
AA seq 135 aa AA seqDB search
MSWQAYVDSSLVGSGHIDKAVIVSAAGDSTWAASPGFTVGADELQNIVKILNEENKETGP
AVSKAYSDGIHVAGERYVATRIEDRHVYGRQGRTGICIVKTKQAILIGHYGENVQAGNAT
ATVESLADYLINLGY
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcttatgttgactcgagcttggttggctccggccacatcgacaaggcc
gtcatcgtcagcgccgcaggtgacagcacctgggccgcgtccccaggtttcacagtcggc
gccgacgagctccagaacatcgtgaagatcctgaacgaggaaaacaaggagacgggtccc
gccgtttccaaggcctactcggacggcatccacgtcgcgggcgagcgctatgtggccacg
agaatcgaggaccgccatgtgtacggtcgtcagggcaggacagggatttgcatcgtcaag
acgaaacaggccattctcatcggccactacggcgagaatgtccaggccggcaacgccaca
gccaccgtcgagtcgctcgccgactatctgatcaacctcggctactaa

DBGET integrated database retrieval system