KEGG   Thielavia terrestris: THITE_2115543Help
Entry
THITE_2115543     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ttt  Thielavia terrestris
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THITE_2115543
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THITE_2115543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(7596456..7596751,7596806..7599690,7599753..7601116)
Genome map
AA seq 1514 aa AA seqDB search
MDVANSTAVSRVTTAVTVMGAVDSHPNRLSSAVAAASDVANAHGSSSWLGLFARIVLWIL
QLVSTVLYYSIKLATISIPTLLYTLFSTSLTVTMNATTLMLILAAMIAAISWVVRYRYLN
MYSRLPPEPQRKEPEVDLFPDTHEEGIKPGLSNYFDEFLSAIKIFGYLERSVFHELTRSM
QTRKLIAGETFNLEEEKGFCLVVDGLVEIFVKSSSYNRRFVANSPLVGPAGETPSSDDEH
DHPGQQRYQLLTEVRNGAPMSSLFSIMSLFTEDVALRQADDDSSESGTAAHSTLFPSYPA
SADFRKSRVASHSLPGTPQLDGSAENLPEHLAPASADRDLPRVPPISLDGNGFSRSQGPL
PKRNSTTSAHPDIIARATVDTTVAIIPASAFRRLIKIYPKATAHIVQVILSRFQRVTLAT
AYNYLGLTCEVVQLERQMLKYTTQQLPNHLRGDALDRLKEKFKRERERIGEEDVSKGIAL
HNARAGRRRRSTATLRKEAALQAFSKQRQLSMTGSPSMSTASAGDLVRHLQQSRSAGNRP
QSVAFIDGPSPHLDLRGDASSPLAQRTFNPFATQRNVHLSLDKRDTLDEDNLFRESILEC
MFKAIGLTGSGGSNRDADSAQASPRLVSFDQRRQKAVFTTHAFGFMDGFEASADGDSESM
TSAGPSAPPSPNPHVLAQEIRDEMEIVFFPKGSVLVEQGERNPGLYYVVDGFLDICTQEE
VSSSDVVHATGRRSLHAMDTVESLCNPQRVARTMRTGNELRDTEKTPKPYRRSVALIKPG
GLAGYVGTISSSRSFIEVVAKTDVYVGFLPLASIERIVDRYPIVLLTMAKRLTNLLPRLI
LHIDFALEWLQVNAGQVIFHEGDESEAIYIVLNGRLRLVEDRKDGGMNVKAEFGQGESIG
ELEVLTESSRSGTLHAIRDTELVKFPRTLFNSLAQEHPNITIKISKIIASRMRALMDDPS
TVLGTKDPSGRSSVNKSSTTLNLRTVAVLPVSSGVPVVEFGNRLLNALTEVGAPNGATSL
NSAAVLNHLGKHAFNRMGKLKLSHYLADLEEKYGLVIYVADTNVNAPWTQTCIAQADCVL
LVGLADGSPEIGEYERFMLGMKSTARKILVLLHEERYSTPGLTRKWLKNRVWINGGHFHV
QMTYSPNVVPIHPPAKPGGPTLRERVQIIQAEIQKYTSRKARASPFYSPDAPFKGDFHRL
ARRLCGKSVGLVLGGGGARGIAHIGIIRAMQEAGIPVDLVGGTSIGAFIGALYARHADFM
PIVHAAKKFAGRMSSMWRFALDLTYPSASYTTGHEFNRGIFKAFGDTQIEDFWLDYYCNT
TNISKSRAEFHTSGYAWRYVRASMSLAGLLPPLCDEGSMLLDGGYIDNLTVSHMKSLGCD
VIFAIDVGALDDDTPQSFGDSLSGVWAFFNRWNPFSSVPNPPTLAEIQARLAYVSSVDAL
ERAKTMPGCIYMRPPIDEYGTLDFGKFTEIYAVGYAYGQEFLGKLKEKGMLPLAEETEGK
KALRRTMAPRRASI
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagccaactctaccgccgtctcgagagtgacgacggcggtcacggtgatgggt
gccgtagacagccacccgaaccggctctcgtcggccgtggctgcagccagcgacgtcgca
aatgcccacggctcgtcgtcgtggctgggcctctttgcccggatcgtgctctggatcctg
cagctcgtctcgactgtgctgtactattcaatcaaactggccaccatctccatcccgacc
ctgctctacactctcttctcgacgagcctgacggtcaccatgaacgctaccacgctcatg
ctcatcctggcagccatgatagctgccatcagctgggtagtccggtatcgttacctcaac
atgtactcccgcctcccacccgagccgcagcgcaaggagcccgaggtcgatctcttcccc
gacacgcacgaagagggcatcaagcccggcttgtccaactactttgacgagttcctgagc
gccatcaagatctttggctatcttgagcggtccgtcttccacgagttgacccgcagcatg
cagacccggaagctcatcgccggcgaaaccttcaacctcgaggaggagaaggggttttgt
ctggtcgtcgatgggctggtcgagatctttgtgaagtcgtccagctataaccggcgcttc
gttgccaacagcccccttgtcggccctgccggcgagacgccctcgagcgacgatgagcac
gaccaccccggacagcaacggtaccagctcctgactgaggttcgcaatggcgcgcccatg
tcgtccttgttttccatcatgtcgctctttaccgaggacgtcgcgttgcggcaggccgac
gatgatagctccgagagtgggacagccgctcacagcaccctctttccaagctaccctgcg
agcgccgacttcaggaagtcgcgtgttgcgtcgcactccctacccggcacccctcaactt
gacggctccgctgagaacctccccgaacatctcgcgcccgccagtgccgaccgcgacctg
cctcgtgtgccccctatctcgctcgacggaaatggcttttcccggtctcaagggccccta
cccaagcggaacagcaccacctctgctcatccggacatcatcgcgagggcaaccgtggac
acgaccgtagccatcattcctgccagcgccttcaggcggctgataaagatataccccaag
gctacggcgcacatcgttcaagtcattttgtcgaggtttcagagagttacccttgctacg
gcgtacaactacctaggcttgacctgcgaggtggtccagttagaacgccagatgctgaag
tacacgacacagcagctcccaaaccatctccgaggggatgcccttgacaggctgaaagag
aagttcaaacgcgaaagggagaggatcggggaggaggatgtcagcaaggggatcgctctc
cacaacgcccgtgctggccgccgccgccgctcaacggcgacgctccggaaggaggcagcc
ctgcaagctttttccaagcaacgccaactatccatgaccggcagcccgtccatgagcact
gcgagtgctggcgatctcgtcaggcacctgcagcagtcaaggagcgcaggcaaccgcccc
cagagcgtggcttttatcgacgggccgtctccgcacctcgatttgcggggagacgcctca
tctcctctggcgcagcgcaccttcaatcccttcgcgacccagaggaacgtacatctttcg
ctggacaagcgagacacgctcgacgaggacaacttgtttcgcgagtcgatcctggaatgt
atgttcaaggccatcgggttaaccggcagtggcggctcgaatagggatgcggactcggcg
caggcctctccgcggctagtatccttcgaccaacggcggcaaaaggcggtcttcacgacc
cacgcatttgggttcatggacgggttcgaagcatcggctgacggtgactcggagtccatg
acctctgccggaccgtccgccccgccgtcaccgaatccccacgtgcttgcacaggagata
cgggacgagatggagatcgtttttttccccaaagggtccgtgttggtggaacaaggcgag
agaaacccagggctctactacgtggtcgacggttttctagatatttgcactcaggaggag
gtatcgtcgtccgatgtcgtccacgctacgggcaggaggtctctgcatgcgatggatacc
gtcgagtcgctatgcaacccgcagcgggtggcgaggacaatgcgcacgggcaacgagctt
cgcgacacggagaaaacgcccaagccttaccgccggagcgtggccctgatcaagccgggt
gggctcgctgggtatgtcggcacgatctcgtcgtccaggtccttcatcgaggtcgtggcc
aagacggacgtctacgtcggcttccttccgctggcctccatcgagaggattgtcgaccgg
tatcccattgtgctcctgaccatggcaaagcggctcacaaacttgctgccgcgtctgatc
ctgcacatcgattttgccctcgagtggctgcaagtgaatgccggccaggtcatattccac
gagggcgacgaaagcgaggccatctatatcgtcctgaatgggcgcctaaggcttgttgaa
gaccggaaggatggcgggatgaacgtcaaggcggagttcggacagggggagagcattgga
gagctggaagtgctgaccgagtcttcgcgctccggcacgctgcacgcgatccgagacacg
gaactcgtcaagtttccacgtacgctcttcaacagtctcgcgcaggagcatcccaatatc
acgatcaagatttccaagatcatcgcatcccggatgagggcactcatggacgacccttcg
accgttttgggaaccaaggacccgtctgggaggagctcggtcaacaagagctccaccacg
ctcaacctgcggaccgtggccgtgctgccggtctcgagcggtgttccggtcgtcgagttt
ggcaataggctgctgaacgcgctgaccgaggtcggggctcccaacggcgccacgtcgctg
aacagcgcggcagtgttgaaccatcttggcaagcacgcatttaacagaatgggcaagctc
aagttgtcgcactacctggcggatctggaggagaagtacggtcttgttatttatgtggct
gacacgaacgtcaacgccccgtggacgcagacctgcatcgcccaggcagactgcgtcctt
ctggtcggcttggccgatggctcgcctgagattggagaatatgagcggttcatgctcggc
atgaagtcgacggcgaggaagatcctcgttctgctgcacgaggaacgctactcgaccccc
ggcctgacgaggaagtggctcaagaaccgcgtgtggatcaacggcggccacttccacgtg
cagatgacatacagccccaacgtggtgccgatccatccgcctgcgaagccgggaggcccg
acgttgagggaacgggtgcagatcatccaggccgagatccagaagtacacgtctagaaag
gcgcgcgccagcccgttctactcgccggatgcgccgttcaagggggatttccaccggctc
gcacggcgcctctgtggcaagtcggtcggcctggtgctgggcggcggcggagcgaggggc
atcgcgcacatcggcatcatccgcgccatgcaggaagcgggcatcccggtcgacctggtc
gggggcacgtcgatcggcgccttcatcggggccctgtacgcgcgacatgccgacttcatg
cccatcgtgcacgcggccaagaagttcgcggggcgcatgtccagcatgtggcggttcgcg
ctcgacctgacgtacccgtcggcgtcgtacacgacgggccacgagttcaaccgcggcatc
ttcaaggcgttcggcgacacacagatcgaggacttctggctcgactactactgcaacacg
accaacatctccaagagccgggccgagttccacacgagcgggtacgcgtggcggtacgtg
cgggcgtccatgtcgctcgcgggcctgctgccgccgctctgcgacgagggcagcatgctg
ctcgacggcggctacatcgacaacctgaccgtgtcgcacatgaagtcgctcgggtgcgac
gtcatcttcgccatcgacgtgggcgcgctcgacgacgacactccgcagagctttggcgac
tcgctgtcgggcgtgtgggccttcttcaaccggtggaaccccttctcgtcggtgccgaac
ccgccgacgctggccgagatccaggcgcgcctggcgtacgtctcgagcgtcgacgcgctg
gagcgggccaagacgatgcccgggtgcatctacatgcgcccgccgatcgacgagtacggg
acgttggacttcggcaagtttaccgagatctacgcggtcggctacgcgtacgggcaggag
ttcttgggaaagctgaaggagaagggcatgctgccgctggcggaggagacggaggggaag
aaggcgctgcggcggaccatggcgccgcggagagcgagtatttag

DBGET integrated database retrieval system