KEGG   Thielavia terrestris: THITE_2116096Help
Entry
THITE_2116096     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ttt  Thielavia terrestris
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ttt00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(8786650..8786803,8786888..8786938,8787001..8788088,8788159..8788527)
Genome map
AA seq 553 aa AA seqDB search
MNPDAPAGPAKPDRPRTPVSDAEAARAGGDQVLVLSPGVTLTLGPDALLLSGQLATKPDR
SCLCIALPGSRGTPSSIPYYNVLWAEITGDRRWLRIDYADQTQPHHVEVRSAKFAIPELP
IEQATPGAGDQVASWVEQLLDRAYRGSARCKRAWVLVNPHAGPGGADRIWQDDVRPIFEA
ARMPLTVVRTSYSGQAVDLARELDIDNYDIAVPCSGDGLPHEVFNGLAKRPDARRALSKI
AVCHIPCGSGNAMSCNLYGTHRPSLAALAIVKGVPTPLDLVSVTHGDQRTISFLSQALGL
IAEVDLGTENLRWMGATRFTFGFLKLVMQRKTYPCDIAVKVEIDDKEEVKRHYRQRVAQP
GREVSKTGEQPQGPADKQSSVSSSAADATDRPDSDDSLGLPPLKYGTVMDKLPEGWELIR
HEKLGSFYCGNMAYMAPDANFFSAALANDGFMDLITTDGDISPLKSIGLQLAVESGHFFD
SPLVSYRKVSAFRIIPRNQETGYISIDGEAIPFGPIQAEVHQGLGLTLSKRGAFEAPGPL
NWDTVTTSERLLA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgacgcgcctgccggcccggcaaagccggaccggccgcggactccggtgagc
gatgctgaagcagctcgcgctggaggcgatcaggtgctcgttttgtctccgggggtgacc
ctcaccctcgggcccgatgctctgctcttgtctggccagcttgcaaccaagcccgatcgc
tcgtgtctttgcattgcgctcccagggtctcgtggcacgccaagcagcattccttattac
aacgtcctctgggccgaaatcaccggcgaccggaggtggctccggattgactatgcagac
cagacgcagccgcatcatgtagaagtccgcagtgccaaattcgctattcccgagctacct
atcgagcaggccacccccggcgcgggcgaccaggtggcctcgtgggtcgagcagctcctg
gaccgcgcataccgcgggtcggcccgctgcaaacgtgcctgggttctcgtgaacccacac
gccggccctggcggggccgacaggatctggcaggacgacgttcggccgatctttgaggca
gcacggatgcccctgaccgtcgtgcgcaccagctactccggccaggcggtcgacttggcc
cgcgagttggacattgacaactatgacatcgccgtcccctgctcgggagatgggctgccc
cacgaggtgttcaacggtcttgccaagcgtccggacgcccgccgcgccttgtccaagata
gctgtgtgccacattccctgcgggtctggcaacgccatgagctgcaacttgtatggcacc
caccggccgagcttggcggcgctggctatcgtcaagggtgtgccgacgccgctggatttg
gtcagcgtcacgcacggggaccagcggaccatcagcttcctcagccaggcgctgggcctg
attgcggaggtggacctgggcactgagaatctgcggtggatgggcgccacgcgtttcacg
tttggcttcctcaaattagtcatgcagcggaagacatacccgtgcgacattgccgtcaaa
gtcgagattgacgacaaggaggaggtgaaaaggcactatcggcagcgggtggcacagccc
gggcgggaagtttcaaaaactggcgagcaacctcagggacccgcggacaaacagtccagt
gtctcgtcctcggcagccgacgctacggatcgtccggacagtgatgacagtctcgggctt
ccacccttgaaatatggaacggtcatggataagctgcccgagggctgggagctcatccgt
catgagaagctcggtagcttctactgtggcaacatggcctacatggcgccggacgccaat
ttcttctcggcggcgcttgccaacgacggcttcatggaccttatcacgactgatggcgac
atatcgcccttgaagtccatcgggctacagctggccgtcgaatcgggccacttcttcgac
agtccgctcgtgtcgtaccgcaaggtgtccgccttccgcatcattccgcgcaaccaagaa
acgggctacatcagcatcgacggtgaggccatccccttcggcccaatccaggccgaagtc
caccagggcctcggccttactctgtccaagagaggcgcgttcgaggcaccgggcccactg
aactgggacaccgtgactaccagtgaacggcttttggcctag

DBGET integrated database retrieval system