KEGG   Thielavia terrestris: THITE_2116333Help
Entry
THITE_2116333     CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 10 protein
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     THITE_2116333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 CBM_1
Motif
Other DBs
NCBI-GeneID: 11516039
NCBI-ProteinID: XP_003653793
JGI: Thite2_2116333
UniProt: G2R5G6
Position
3:complement(join(253854..253930,254018..254852,254912..255244))
Genome map
AA seq 414 aa AA seqDB search
MRSQAVWAAILAPATVSATLNDLAVRAGLKYFGTCLSESYINSDSQYAALINDKTEFGGL
VPENGMKWDATEPSQGQFSFSQGDITANTAKKNGQVLRCHTLVWYSQLPGWVTSGSWTRS
TLQSVMQTHITNVMGHYKGQCYAWDVVNEAIADDGTWRTSVFYNTFSTDYIPLAFNIAKT
ADPNAKLYYNDYNLEYNGAKTDTAVQLVQLVQSAGAPIDGVGFQGHLIVGSTPGRSSLAT
ALKRFTALGLEVAYTELDIRHSSLPPSTSALATQGNDFANVVGSCLDVAGCIGVTVWGVT
DKYSWIPQTFPGAGDALLYDDNYNKKPAWTSVSSVLAAKATSPPASSSTTLTTVITTAPT
STPTSTTAPTTTSSSNGAQQTHWGQCGGIGWTGATQCQSPYTCQKLNDWYYQCL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcccaggctgtgtgggccgcgatactcgcgccggccaccgtgtcggccacgctc
aacgacctcgccgtccgggccgggctcaagtacttcggcacctgcctcagcgagagttac
atcaacagcgatagccagtatgcggccctcatcaatgacaagaccgagttcggcgggctc
gtgcctgagaacggcatgaagtgggacgccaccgagcccagccagggccagttcagcttc
agccagggcgacatcacggcgaacacggccaagaagaacggccaggtcctgcgctgccac
accctggtctggtacagccagcttccaggatgggtgacgtcgggctcctggaccaggagc
acgctgcagtcggtcatgcagacgcacatcacgaacgtcatgggccactacaagggccag
tgctatgcgtgggacgtggtgaacgaggccatcgccgacgacggcacgtggcgcaccagc
gtgttctacaacaccttctcgaccgactacatcccgcttgccttcaacatcgccaagacg
gccgaccccaacgccaagctgtactacaacgactacaacctcgagtacaacggcgccaag
acggacacggccgtgcagctcgtgcagctcgtgcagtcggccggcgcgcccatcgacggc
gtcggcttccagggccacctgatcgtcggcagcacgcccggccgcagcagcctggcgacc
gcgctcaagcgcttcaccgccctcggcctggaggtggcctacacggagctcgacatccgg
cactccagcctgccgccgtccacctcggcgctcgcgacgcagggcaacgacttcgccaac
gtggtcggctcgtgcctcgacgtcgccggctgcatcggcgtgaccgtctggggcgtgacc
gacaagtactcgtggatcccgcagaccttcccgggcgccggcgacgccctgctctacgac
gacaactacaacaagaagcccgcctggacctcggtctcgtccgtcctcgccgccaaggcc
accagcccgcccgcctcgtcgtccaccaccctcaccaccgtcatcaccacggccccaacc
tccaccccgacgagcaccaccgcgcccaccaccacgtcgtcctcgaacggcgcccagcag
acccactggggccagtgcggtggcattggctggaccggcgctacgcagtgccagagcccg
tacacctgccagaagctgaacgactggtactatcagtgcctgtaa

DBGET integrated database retrieval system