KEGG   Thielavia terrestris: THITE_2116456Help
Entry
THITE_2116456     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     THITE_2116456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(618399..618500,618573..619199)
Genome map
AA seq 242 aa AA seqDB search
MAWRSSGGSNRDLVENLWRNQLITHQQVKEAFLKVDRAHYAPTFPYEDSPQPIGHAATIS
APHMHASAAEHLLPFVTPAPPARPAPRVLDIGSGSGYLTHVLAELACAGSGADSGAVVVG
LEHIAPLRDLGERNMRKTARGRELLDAGRVRFRVGDGRKGWLEPGEEHKKWDAIHVGASA
AEVHDALLEQLNAPGRMFIPVDDDESGWGQHVWCVDKDEKGVVSRRKLFGVRYVPLTDPP
KE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgcagctcgggcgggtccaaccgcgacctggtcgagaacctctggcgcaac
cagctgatcacccaccaacaggtgaaggaggcctttctcaaggtcgaccgcgcgcactac
gcgcccacgttcccctacgaagactcgccccagccgatcggccacgcggcgaccatctcg
gcgccgcacatgcacgcctcggccgccgagcacctgctgcccttcgtcacgccggcgccg
ccggcgcgcccggccccgcgcgtgctcgacatcggctccgggtcgggctacctgacgcac
gtgctggcggagctggcctgcgccggcagcggcgccgattcaggtgccgtggtcgtcggc
ctcgagcacatcgcgccgctgcgcgacctgggcgagcgcaacatgcgcaagacggcgcgc
gggcgcgagctgctggacgccgggcgggtgcggttccgcgtcggcgacgggcggaaaggc
tggctcgagcccggcgaggagcacaagaagtgggacgccatccacgtcggcgccagcgcc
gccgaggtgcatgatgccctgctcgagcagctcaacgcgcccgggcgcatgttcatcccc
gtcgacgacgacgagagcgggtggggccagcatgtctggtgcgtcgacaaggatgagaag
ggtgtggtcagcaggaggaagctgtttggtgtgcggtatgtgccgttgacggatccgccg
aaggagtag

DBGET integrated database retrieval system