KEGG   Thielavia terrestris: THITE_2116544Help
Entry
THITE_2116544     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ttt  Thielavia terrestris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THITE_2116544
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THITE_2116544
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     THITE_2116544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(1058767..1059530,1059603..1059915)
Genome map
AA seq 358 aa AA seqDB search
MSPFGRNGDIAGAGTLTPPPTTGRNSPRFFGKLNTSMIESKFLAHPEDLGIVAVGFSGGQ
GKPGVDAAPTALIEAGLLTQLRDELGYNLHGHDTVHLYNDLVPAQDPPHRGMKNPRAVSA
VTRRIAGQVYEHAREGRLVLTLGGDHSIAIGTIAGTAKAMRERLGREIAVIWVDAHADIN
TPETSGSGNVHGMPVSFLTGLAREDKDEFFGWLKDEHRISVKKLVYIGLRDVDPGEKRIL
RENGIKAFSMFDIDKYGIGRVVEMALAHIGNDTPIHLSFDVDALDPLWAPSTGTPVRGGL
TLREGDFICESVHQTGSLVAVDLVEVNPRLAPENDIGAHETVRAGCSLVRCALGESLL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccttcggtcgcaacggtgatatcgccggcgccggcacgctcacgccgccgccc
acgacaggccgcaactcgccgcgcttcttcggcaagctcaacacgtccatgatcgagtcc
aagttcctcgcgcacccggaagacctcggcatcgtcgccgtcggcttctcgggcgggcag
ggcaagccgggcgtggacgcggcgccgacggcgctgatcgaggccggcctgctgacgcag
ctgcgcgacgagctcggctacaacctgcacggccacgacaccgtacacctgtacaatgac
ctggtccccgcgcaggacccgccgcaccgcggcatgaagaacccgcgcgccgtgtcggcc
gtcacgcgccgcatcgccggccaggtgtacgagcacgcccgcgaagggcggctggtgctg
acgctgggcggcgaccacagcatcgccatcggcaccatcgccggcaccgctaaagccatg
cgcgagcggctcggcagggagatcgccgtgatctgggtcgatgcgcatgccgacatcaac
acgcccgagacgagcggcagcgggaacgtccacggcatgccggtcagcttcttgaccggt
ctcgccagggaggacaaggacgagtttttcggctggttgaaggacgagcaccggatcagc
gttaagaagctggtatacatcggcctgagggatgttgacccgggggagaagcggatcttg
agggagaacgggatcaaggcgttcagcatgttcgatatcgacaagtacggcatcggccgc
gtcgtggagatggcgctcgcgcacatcggcaacgacacgcccatccacctgtcgttcgac
gtcgacgcgctcgatcccttgtgggctccctcgaccggcacgcccgtgcgcggcggcctg
acgctgcgcgagggcgacttcatctgcgagtcggtgcatcagacgggcagcctggtggcc
gtcgacctcgtcgaggtcaacccgcgcctggcgccggagaacgacatcggagcgcacgag
acggtcagggcgggctgctcccttgtccggtgcgcgctcggcgagagcttgctgtga

DBGET integrated database retrieval system