KEGG   Thielavia terrestris: THITE_2116631Help
Entry
THITE_2116631     CDS       T02228                                 

Definition
ubiquitin carboxyl-terminal hydrolase-like protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THITE_2116631
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2116631
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     THITE_2116631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1288044..1288145,1288238..1288471,1288539..1289329,1289401..1289514,1289591..1289827,1289887..1289971))
Genome map
AA seq 520 aa AA seqDB search
MSARPATPASPKNYKVKSPQPGQPMYGCEHLQRLFNQDQATTNTSIQHYKTILRTIFDTT
PLISQTAKATDGQIVTSLTPTYLCLQCPSTLTEDDRIKHGNKKSHRFYVESRSGALYCQM
CDDIVWDPTFEDLRIRKMGTGTFSTTRKRKHEELFEAADPVRDNPTYISANTTAASCKAN
GLRGIYNAGATCYQNVVLQSFIHNPILRNFYLSDGHQSSNCDTPHCLSCAMDDMFQDFYA
LENTNGYTAANILSGFWISEKKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKKPETGS
EHSCNCIIHQTYYGKLQSTTTCQNCGGVTNQVQSFLDLSLPLENLSQKKSKKAPSRPNGG
VLTLQECLDEEYVKSDKCEYRCNNCNSMQQARRQTSIKRLPNVLAIQLKRFEFKQGRNER
AAKIDTPVQFPLQLNMLPYTNRARSAPESKENYELARSCTYDLLSVVVHVGEIDTGHYLS
YCRVGDQWFAFNDHKVELAQKSDVLNSQAYLLFYIVRSLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgcggcctgccactccggcgtcgccgaagaactacaaagtcaagtcgccccag
ccaggccagcctatgtacggctgtgaacacctgcagaggctcttcaaccaagaccaagcg
accacgaacacctcgatccaacactacaaaacaatactccgtaccatcttcgacacaacg
ccgctcatctcccagacggccaaggcgaccgatggccagattgtcacctcgctcacccct
acatacctctgcctgcaatgtccctcgacattgaccgaagacgatcgcataaagcatggc
aataaaaagtcgcacagattttacgtcgagtcgaggagcggtgctctttactgccagatg
tgcgatgatatcgtctgggaccctacctttgaggacctcaggataaggaagatgggaacg
ggcacattctccacgacccggaagcgaaaacacgaagaactcttcgaggcagccgatccc
gtcagggacaatccgacttacatctcggcgaacacaacagcagcatcctgcaaggccaac
ggcctgcggggcatctacaatgctggggccacctgctaccagaacgtcgtcctccagagc
ttcatccacaacccgatcctacgaaacttttacctgagtgacggccaccagagcagcaac
tgcgacacgccgcattgcctgagctgcgccatggacgacatgttccaagacttctacgcg
ttggagaacaccaacgggtatacggccgccaacattctctccgggttttggatcagcgag
aagaaggcgttcgagaacctggtcacaaccaaggagcaggatgcacacgagttcttccag
ttcctggccgaggagctgcacgagcgcaacggcgacggcaagaagcccgagaccggcagc
gagcacagctgcaactgcatcatccaccagacgtactacggcaagctccagagcaccacc
acgtgtcagaactgcggcggcgtgacgaatcaggtgcagagcttcttggacctcagcctg
ccgctggagaacctctcgcagaagaagagcaaaaaggccccgtcaagaccaaacggcggc
gtgttgacgttgcaggagtgtctcgacgaggagtacgtcaagtcggacaagtgcgagtac
cgctgcaacaactgcaactcgatgcagcaggcgcggcggcagacgtccatcaagcggttg
ccgaacgtgctcgccatccagctcaagaggttcgagttcaagcaaggccgcaacgagcgt
gccgcaaagatcgacacgccggtgcagttcccgcttcagctcaacatgctcccgtacacg
aaccgggctcgcagcgcgcccgagtccaaggagaactacgagctggcgcgctcgtgcacg
tacgacctcctcagcgtggtcgtgcatgtaggggaaatcgacaccggccattacctgtcg
tattgccgagtcggcgatcagtggtttgcgttcaacgaccacaaggtggagttggcgcag
aagtcggacgtgctcaactcgcaggcatatcttctgttctacattgttcgatcgttgtcg
taa

DBGET integrated database retrieval system