KEGG   Thielavia terrestris: THITE_2116654Help
Entry
THITE_2116654     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THITE_2116654
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   THITE_2116654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1306454..1307034,1307094..1307290,1307343..1307524,1307578..1307680,1307751..1307845,1307900..1308208))
Genome map
AA seq 488 aa AA seqDB search
MTQEAIPPAGESYLEGGDGGSSLPVRRSGRVRKRMLPFNDDADHPKERPAASSNSTSARR
NSQRKAAPEVFDIPDNLLEASLAPWKENEKAEWASWVELESDPAFFTAILGLLGVKGARI
VELLSADEDSLAALPAPVYGMIFLFEYVGESMDEGKNNEPSEDVWFANQTTNNACATIAL
LNILMNTEGLQLGEKLLRFKQESKGLSAPLRGHMITNSTWIRTAHNAFSRRLDLLNAVLA
VQNDVDQKKIRTKAKRKKAKAKVSDNDTAYHFIAFVPIGQKVWQLDGLSNKPVFLGEYAP
GQHWTSAVSPVIQQKMAHHEMELSFSLLALCADNASQLRQKLAANVRRLESLETRFKSNS
EWKPKANSSIIHSSSDDRLPLYQLDAEDIRTSVSDEKTPEPTSGTVEAGLQAWEQLCDEQ
QRLRSQYEDELGGLETTGVLGRTKDHTPAIHEWVKLLAGHGVLMQLHEEASRHNAPWPGV
VGQRPSGM
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggaggccataccccccgccggggaaagctacctagaaggtggcgacggcggc
tcctctctcccggttcgccgttccggccgcgtccgcaagaggatgctgccatttaacgat
gatgccgaccacccaaaggagcggccagccgcatcgtccaacagcaccagtgctcgccga
aactcgcaaagaaaggcggccccagaggtctttgacatacccgacaatctgctggaggcg
tcactcgcgccgtggaaagaaaatgagaaggcagaatgggcgagctgggttgagttggaa
tctgatccggcttttttcacggccattcttggcctcctcggcgtcaaaggagccagaata
gtagagctgctctccgccgatgaggactctttggccgctcttcctgctccggtttacggc
atgatatttctgtttgagtacgtcggagaaagtatggatgagggaaagaataatgagccg
agcgaagatgtgtggttcgcgaaccagaccacaaacaacgcatgcgccactattgcactg
ctcaacattctcatgaataccgaagggctgcagctcggtgagaagctcctcaggttcaag
caagaatccaaagggttgtcggcgccattgagaggccatatgattacaaacagcacctgg
atacggacggctcacaacgccttttctcgccggttggacctcttgaatgcggtcctcgcc
gtccaaaacgacgtggaccagaagaagatccgaaccaaagcgaagcggaagaaggccaaa
gccaaggtgtcagacaatgacaccgcctaccactttattgcattcgtccccatcgggcaa
aaggtgtggcagcttgatgggctctcaaataagcccgttttccttggtgaatatgcgcca
ggtcagcactggacatcggcggtaagccccgtcatccagcaaaaaatggcgcatcacgag
atggagctgtcattcagcctcctcgctctctgtgccgacaatgcttcccagcttcggcag
aaacttgccgccaacgtccgccgcttggagagtctcgagacgaggtttaaaagcaactcc
gaatggaagccgaaggcgaactcgagcattatccacagctcgtcagacgaccgcctcccc
ctataccaactagacgctgaagacatacgaacctcagtcagtgacgaaaagacgcccgaa
ccgaccagcgggacggtcgaggccgggctacaggcctgggagcagctctgcgacgagcaa
cagcgtctgcgctcacagtatgaggatgagctcggcggtctggagacaacgggggtcctt
ggccggactaaggatcacacgcctgccatccacgagtgggtcaagctgcttgccggtcac
ggagtgctgatgcagctgcatgaggaagcgagccggcacaacgccccttggccgggagta
gtcggccaacggccatctggaatgtga

DBGET integrated database retrieval system