KEGG   Thielavia terrestris: THITE_2116724Help
Entry
THITE_2116724     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ttt  Thielavia terrestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THITE_2116724
Enzymes [BR:ttt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     THITE_2116724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(1397779..1398055,1398117..1398727)
Genome map
AA seq 295 aa AA seqDB search
MASKIPVFLLKTRSVPGDAYEELFSTPADGFDFEPSFVPVLEHRFDEEGLAKVRSALQNR
SISSAVDSTYGGLIFTSQRAVEAFAKLVEERRGEEDGWPHLQDVPVYSVGPATTRALKAV
PQVPPLQVFGEHTGSGDKLAPFILEHYGEWYKGREPMPPLLFLVGDKRRDVIPRVLTEAG
WRLDEVVVYGTGELESFKEDFTQRLRETADRPLRWVVVFSPSGCGSMLSALGLLDESTGR
AKPKQPDRDTLIATIGPTTRDHLMQKFGYEPDACAKQPTPEGVWQAISRFSKGSE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaataccggtcttcctgctcaagaccaggtcagttcccggcgatgcctat
gaggagctcttttcaacccctgcggatggtttcgacttcgagccgtccttcgtcccggtg
ctcgagcaccgctttgacgaggaagggctagccaaggtgcgcagtgcgctgcagaacagg
tcgatcagctcggctgtggacagcacctacggcggcctcatattcacctcgcaacgcgct
gtcgaggctttcgccaagctcgtcgaggaaaggagaggggaagaagatggttggccgcat
ctgcaggacgttcctgtctacagtgttgggcccgcaaccacgcgcgccctgaaggcggtt
ccccaagtgccccctctacaagtctttggtgagcacaccgggtctggcgacaaactggcg
cccttcattttggagcactacggagaatggtacaaaggccgagagcccatgcctcctctg
ctcttccttgtgggcgacaaacggcgcgatgtcattccccgggtgctgacagaggcgggg
tggcgcctggacgaggtggtcgtctacggcaccggggaactggagtcgttcaaggaggac
ttcactcagcgtcttcgggagacggcagaccggccattgagatgggtggtcgtgttctct
cctagcgggtgcggcagcatgctgagcgccctgggtctgcttgacgaaagcaccggcagg
gccaagccaaagcagccagatcgagacaccttgattgcgacgattggaccgacaacacgc
gatcatctgatgcaaaagtttgggtacgaaccagacgcctgcgccaagcagccgaccccg
gagggcgtctggcaagccatttcccgcttcagcaaaggctcagaatag

DBGET integrated database retrieval system