KEGG   Thielavia terrestris: THITE_2117180Help
Entry
THITE_2117180     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(2495897,2495985..2496020,2496075..2497594,2497685..2498102,2498170..2499628,2499720..2500116)
Genome map
AA seq 1276 aa AA seqDB search
MIQIAEPRVPGKGGRLASRLIQDWFAGRLAQNEQGDSGSVGLPTDCPSLRVFPPRPEAGP
EHDLLIIQSQSYDDAHDPENQGRSLVCCMCRYCRYHFVFHIYPPAREDGMTHMQHHLRLK
EFQRLPFASPPPSPPSTRRPQPCRFLYDCTVCGMVVCLDMSLPRLQSGWIELITDENRIR
EALRIAREQDPGRYGDISPEKENHYLTTALSTLNQYLKNILDDDGSGPRKRISCRNKTFL
VQFGQDCDQMFRYLGFEQQHDPATGEWYWLPPVLPPQSGKTPLNSPRAFIEDVRSEVQSL
LDDKPLPNGQPVVKPFSARDQLEKALGCDKTPRSAGPPSIDSSELQHFTTLGAPVGASDE
LLKFAYRRQVETDPEGAPSYLEALGTLSGRRAEELQMFVFGEQELLAEKDKQAVATATAA
DPETAAIERAYAHFALRRDCPEAPAYFINVYRNYREQSPAQKSDHRLALLTIGRDRHSEE
IEYEVYMTDMELSEACRFLGVDAEWPLDNIAAMAQSVASEMDLKLVLMALDTIGRSRPAD
DPNRYAFDETVLMLRSGLPSSPLDSSATPTAEPSREVVDMELPVGLANLRNTCYLNSILQ
YFYSVNAVRDLAMNADLPALQPTEENLSNLLRATNSGGSDSSPTGSSLETGRAFVGHEFT
RELSTLFRELDATGSSWITPRQRLANAALLRPEKLRPRSEGSETAPSSSNDAGPPLPPRT
AHESSVPRVPDAPMTEPECCETASAASSQTLVNNAGEEGAAGATTEPRNAEKDAPTAADE
AVAQTSASPKSNQPAQRGVRMSKLTVEELAVELDKPNVGSDQMDVDEVMGNAIDHLRAAF
KVSRIGSSEAAPDPIQQAFFSTFIDNRKKIGDSEWNRSRRSDRWVTAYPAQSGTRDLYDA
LANSFDLEPLPGDLLSFTTIERPAPHFHICIQRSDGVRKNSNPITIPNVLYLDRFMHAAD
NQSVLSRERRRRWDITTRLNEISSSKSADGRPETAKADSRVAGHALKVGMQEDDLTEEEI
DGFLIVGSSGVPAVDSSSSTAAAVNGTRGAEEVTPDSELKRLLVKYGLAEPAFARSGSAE
PPPYNNTNSTKTTTLLPSDIDAFWERFAAEEDAERQRLTAERDRIFADAHNVAYLLHAVV
CHAGARPTSSSRSSTPRASRTTWPTSGPTRSRTWSASRAATRPRRRRCPRVPSRPSRNGI
SLWSMRTGPDRPRPPSSTWRTWICRPTRSTTASEGLFRARKHMHGDIGELPIACSHMPSV
GYSTTKRPVHQHTCFS
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaattgctgagccgcgtgtccccggaaagggcgggcgtctagcctctcggctc
atccaggactggttcgcggggcgtctagcgcagaacgagcaaggtgacagcgggagcgtc
gggctgcctaccgactgcccgtcgctacgagtgtttcctccccgcccggaagccggcccc
gagcatgacctgctcatcatccagtcgcagagttatgacgacgcccacgaccccgagaat
caaggcaggtccttggtttgctgcatgtgcaggtattgccgctaccatttcgtcttccac
atctaccctcctgcgcgcgaagacggcatgacgcacatgcagcaccatctccgcctcaag
gaattccaacggctccccttcgccagccccccgccttcgcctccatccacccggcgtccc
caaccgtgccggtttctgtacgactgcaccgtgtgcgggatggttgtctgcctcgacatg
tcgttgcctcggctgcagtcgggctggatcgagttgatcacggacgagaaccggatccgg
gaggcgttgaggatcgcccgagagcaagaccctggacgctacggggacatcagcccggag
aaggagaaccactacctgacaacggccctctccacgttgaaccagtatctcaaaaatata
ctggatgatgacggctcggggccccgcaagaggatatcttgccggaacaagacatttttg
gtgcagtttggccaggattgcgaccaaatgttccgctatctcgggtttgagcagcagcac
gaccccgccaccggagagtggtactggctgcctccggttttgcctcctcagtcgggcaag
acgcccctgaattcgccgagggctttcatcgaagacgtcagaagcgaggtgcagagcctc
ctcgacgacaagccgcttcccaacggccagcccgtcgtcaagccgttctcggcacgagac
cagctggagaaggctctcggatgcgacaaaaccccacggtctgcgggtccgccgtctatt
gacagcagcgagcttcagcatttcaccaccctcggcgcgccagtcggcgcaagcgatgag
ctgctcaagttcgcgtacaggagacaagtcgagaccgacccggagggcgcaccatcttat
ttggaagcgctcggcacactctctgggcgcagagccgaggaactccaaatgtttgttttc
ggagagcaggagttgctggccgaaaaagacaaacaagcggtggccaccgccaccgccgcg
gaccccgagaccgctgccatcgaaagggcatacgcccactttgctctgcggagagactgt
cctgaagcgcccgcgtacttcatcaacgtgtacaggaactacagagaacagtctcccgca
cagaaatcagaccatcggctcgccttgctcacgattgggagagaccggcacagcgaagaa
attgagtacgaggtgtacatgaccgacatggaactctcggaggcctgccgattcctgggc
gtggacgccgaatggccgttggacaatatcgcggcgatggcacagagcgttgcttcggag
atggaccttaagcttgtccttatggcgctcgacaccatcgggcgaagtcggcccgcggat
gacccaaaccgttacgcgtttgacgaaaccgtgctcatgctgcgatccggccttccatcc
tcgcccctagatagcagcgcgacacctaccgctgagccctctcgcgaagttgtggatatg
gagcttccggtcgggctcgccaatcttcggaacacctgctatctgaatagcattcttcag
tatttctactccgttaacgccgtcagggacctcgctatgaatgccgacctgcccgccttg
cagccgaccgaggagaatctgagcaatctgctccgcgccaccaacagcggcggcagtgac
agcagcccgaccgggtccagcttggagacggggcgagccttcgtcggacatgaattcacg
cgcgagctgagcacccttttccgggagctcgacgccactggaagtagctggatcacgcct
cggcagcgcctcgccaatgctgctctgctgaggccggagaagctgcgtccccgctcagag
ggttccgaaactgcgccgagctcgagcaacgatgccgggccgccactgccgccccgcacg
gcccacgagagctccgtcccccgcgtgcccgatgcccccatgacagaacccgaatgctgc
gagaccgctagtgccgcgagctcacaaacgctggtaaacaacgctggtgaagagggcgct
gcgggtgccacgactgagccgcggaacgccgagaaggacgcgccgacggccgcggatgag
gctgtagcgcaaacatccgctagccccaagtccaaccaacccgcccagaggggagtgaga
atgtcgaagctcactgtcgaagagcttgccgtcgagctggacaagccaaacgtcggatcc
gatcagatggacgttgacgaggtcatgggtaacgccattgaccatctgcgggcggccttc
aaggtatcccgtattggcagttctgaggccgctccggaccccatccagcaagccttcttc
tcaaccttcatcgataaccggaagaagattggcgattccgagtggaaccggtccaggaga
tccgaccgctgggtgacggcgtaccctgctcagtcagggacgcgggacctgtacgatgcc
ctggccaactcatttgacctcgagccactccccggcgacctcctttctttcaccacgatc
gagcgaccggcgccgcattttcacatctgtatccagcgctcggacggcgtgaggaagaat
tccaaccccattaccatcccgaacgttctctatctcgaccgcttcatgcatgccgccgac
aaccagtcagtgctatccagggagaggaggcgccgatgggatatcacgaccagactgaac
gagatatcaagctcgaagtcggcggatgggcgccctgagacagccaaggccgattcccgg
gttgccggtcacgctttgaaggtcggtatgcaagaagatgacctcaccgaggaggagatc
gatgggttcttaatcgttgggagctctggcgtccccgctgtggactcatcatcctccaca
gccgccgcggtgaacgggacacgaggtgcagaggaggttactcctgactcggagttgaag
cggctgttggtcaagtatggtctagcagagcccgcctttgctcgctccggctccgccgag
ccaccaccgtacaacaacaccaacagcacgaagacgacgaccctactgccatctgacatc
gacgcgttttgggagcgatttgcggccgaggaggatgcagagaggcagcgcctgaccgcc
gagcgcgacaggatctttgcggacgcccacaacgtcgcctatcttctccacgccgtcgtg
tgccacgcgggcgcccggccgacttcgtcttccaggagctcaacaccaagggcgagccgt
actacctggcctacgtcagggccgacgaggtcgcgcacctggtcagcatcccgcgccgcc
acccgcccacgccgccgccggtgcccccgcgtccccagccgccccagccggaacgggata
tcgttatggtcgatgcggacgggcccggaccggccgagaccgccgtcgagcacctggagg
acgtggatatgcaggccaactcgctccacgaccgccagtgaggggctgttccgtgcgcgg
aagcacatgcatggcgatatcggggagcttcctatcgcatgcagtcacatgccgtccgtc
ggatattccacgacgaaaagacctgtccaccaacacacgtgtttttcttag

DBGET integrated database retrieval system