KEGG   Thielavia terrestris: THITE_2117532Help
Entry
THITE_2117532     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     THITE_2117532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(3080993..3082147)
Genome map
AA seq 384 aa AA seqDB search
MSQVQRWGDEYGGVIAGAPAFRFAQQQVLHVLSSTVEKMLDYLPPPCELAKIVNATIAAC
DGLDGRSDGVVSRTDLCKLKFNLKSVIGESYYCAAKNSTSLGSGFNKAKRQAPGSQTSYQ
LEQSGTVSAKGVAVAQAIYDGLHNSAGERAYLSWQIASELADASTTYNSAIGAWELNIPS
IGGEYVTKFVQLLDLDNLPSLDNVTYDTLVDWMTTGMYRYMDSLQTTLPDLTTFQSSGGK
LLHYHGESDSSIPAASSVHYWQSVRSVMYPSLSDEQSLAALADWYQLYLVPGAGHCGANP
LQPGPFPRNNMNVMIDWVENGVRPSRLNATVSSGKYAGETQMLCQWPTRPLWRSNDSSTF
DCVTDAASYESWTYTFPAFKVPVY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtccagcgctggggcgacgagtacggcggcgtcatcgcaggtgccccggct
ttccgctttgctcagcagcaagtcctccatgtcctctcttccactgtggaaaagatgctc
gactatcttccacccccgtgcgagctggccaagatcgtcaacgccaccattgctgcctgc
gatgggcttgatggcaggagtgacggggtcgtgtcgagaaccgatctctgcaagctcaaa
tttaacctcaagtcggtcatcggagagtcctactactgcgccgccaagaacagcacctct
ctcgggtctggcttcaacaaggccaagcgccaggcaccggggagccaaacgagctaccag
ctcgagcagagcggcaccgtgagtgcaaagggcgtcgctgtagcccaggccatctacgac
gggctgcacaactcggccggagagagggcgtatctctcctggcagatcgcctcggaactt
gcggatgcgtccacgacctacaactcggccatcggcgcctgggaactcaacattccgtcg
atcggaggcgaatatgtcactaagttcgtccagctcctcgacctcgacaacctgcccagc
ctggataatgtcacgtacgacacgctggtggactggatgacaaccggcatgtaccggtac
atggacagcctgcagaccaccctgcccgatctcaccaccttccagtcctccggcggcaag
ctgctccattaccacggcgaatccgactccagcatccccgccgcctcctccgtgcactac
tggcagtccgtgcggtccgtcatgtaccccagtctctccgacgagcaaagcctggcggcg
ctcgcggactggtaccagctctacctggtcccgggcgccggccactgcggagccaacccc
ctgcagccggggccgttcccccgcaacaacatgaacgtcatgatcgactgggtcgagaac
ggcgtcaggccgtccaggctcaacgccaccgtctcgtctggcaagtacgccggcgagacc
cagatgctctgccagtggccgactcgccccctctggcgctccaacgacagctccaccttt
gactgtgtgacggatgcggcgagctatgagagctggacctacaccttccctgcgtttaag
gtgcctgtgtactaa

DBGET integrated database retrieval system