KEGG   Thielavia terrestris: THITE_2117640Help
Entry
THITE_2117640     CDS       T02228                                 

Definition
glycoside hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ttt  Thielavia terrestris
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    THITE_2117640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    THITE_2117640
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     THITE_2117640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(3347152..3347980,3348052..3348668)
Genome map
AA seq 481 aa AA seqDB search
MPSLKLALLAAAGAAFGATLHARASPQAYASSGDGTYKLSPVAAPVRGAGSPGSNSTWKL
SINDQSSGYKQTVNGFGAAVTDATVAVFNALPADKLTTLLQELMTDAGANFKLMRHTIAS
SDLSADPAYTYDDNGGNVDTSFSSFNLGDRGTAMAELLAKMKSLQPDLTILGSPWSPPGW
MKLNGVIDGTTVNNNLNHAYASQFAQYFVKYLQAYQSHGVTIDAITIQNEPLNSQAGMPT
MYVYADESGNLIQQNVGPALRAAGFNTAIWAYDHNTDVPSYPQTVLNEASEYVNTVAWHC
YAPNNNWGALTTFHNSNPNVDQYMTECWTSTTTAWNQAADFTMGPLQNWAKGALAWTLGT
DKSEGPHLSGSGPCTTCRGLVTIDTSAGTYNLEVDYYMMAQFSKFIPKGAIVLDGSGSYT
YSGGGGIQSVATLNPDGSRTVVIENTFGNAVYVTLTTAGGETWSGLVYANSVVTWVLPAA
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccctgaaactcgctctgctcgcagccgccggggcagccttcggtgccacgctc
cacgcccgggcttcgccgcaggcttatgcctcaagtggcgacggcacctacaagctctcg
cccgtcgctgcaccggttcgtggtgctggcagcccgggaagcaactccacctggaagctg
tccatcaacgaccagtcgtccggttacaagcagaccgtcaatggcttcggtgccgctgtc
acggacgccaccgttgcggtattcaacgcgcttccggcagacaagctgacgactctgctc
caagagctcatgacggatgcaggcgccaatttcaagctgatgcgccataccatcgcctcc
tcggacctgtctgccgacccggcctacacgtacgacgacaacggcggcaacgtcgacacc
tcgttctcgtctttcaatctgggcgaccgtggcaccgccatggctgaacttcttgccaag
atgaagtctctgcagcccgacctgaccattctcggaagcccgtggagcccgcccgggtgg
atgaagctgaacggtgtgatcgacgggaccacggtcaacaacaatctcaaccacgcctac
gccagccagttcgcccaatacttcgtcaagtacctccaggcctaccagtcgcatggtgtc
accatcgacgccatcaccatccagaacgaacccctgaacagccaagcgggcatgcctacc
atgtatgtctacgccgacgagtctggcaacctgatccagcagaacgtcggcccagcgctg
cgcgccgcgggattcaacacggcaatctgggcgtacgaccataataccgacgtccccagc
tatccgcagaccgtcctgaacgaggcgtctgagtacgtcaacacggtggcctggcactgc
tacgccccgaacaacaactggggagccttgaccaccttccacaacagcaacccgaacgtc
gaccagtacatgacggagtgctggacgtcgacgacgaccgcctggaaccaggcggcggac
ttcaccatggggccgctgcagaactgggccaagggcgcgctggcctggacgctcggcacg
gacaagtccgagggcccgcacctgtccggcagcgggccgtgcaccacctgccgcggcctc
gtcaccatcgacaccagcgccgggacctacaacctcgaggtcgactactacatgatggcc
cagttcagcaagttcatccccaagggcgccatcgtgctcgacggctccggcagctacacc
tactcgggcggcggcggcatccagtccgtcgccaccctgaacccggacggctcgcgcacc
gtcgtgattgagaacacgtttggcaatgccgtgtacgtgactcttaccaccgctggtggg
gagacctggagcgggctggtctacgcgaacagcgtcgtcacctgggtgctcccggcggcg
tcgtaa

DBGET integrated database retrieval system