KEGG   Thielavia terrestris: THITE_2117640Help
Entry
THITE_2117640     CDS       T02228                                 

Definition
glycoside hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ttt  Thielavia terrestris
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ttt00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ttt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(3347152..3347980,3348052..3348668)
Genome map
AA seq 481 aa AA seqDB search
MPSLKLALLAAAGAAFGATLHARASPQAYASSGDGTYKLSPVAAPVRGAGSPGSNSTWKL
SINDQSSGYKQTVNGFGAAVTDATVAVFNALPADKLTTLLQELMTDAGANFKLMRHTIAS
SDLSADPAYTYDDNGGNVDTSFSSFNLGDRGTAMAELLAKMKSLQPDLTILGSPWSPPGW
MKLNGVIDGTTVNNNLNHAYASQFAQYFVKYLQAYQSHGVTIDAITIQNEPLNSQAGMPT
MYVYADESGNLIQQNVGPALRAAGFNTAIWAYDHNTDVPSYPQTVLNEASEYVNTVAWHC
YAPNNNWGALTTFHNSNPNVDQYMTECWTSTTTAWNQAADFTMGPLQNWAKGALAWTLGT
DKSEGPHLSGSGPCTTCRGLVTIDTSAGTYNLEVDYYMMAQFSKFIPKGAIVLDGSGSYT
YSGGGGIQSVATLNPDGSRTVVIENTFGNAVYVTLTTAGGETWSGLVYANSVVTWVLPAA
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccctgaaactcgctctgctcgcagccgccggggcagccttcggtgccacgctc
cacgcccgggcttcgccgcaggcttatgcctcaagtggcgacggcacctacaagctctcg
cccgtcgctgcaccggttcgtggtgctggcagcccgggaagcaactccacctggaagctg
tccatcaacgaccagtcgtccggttacaagcagaccgtcaatggcttcggtgccgctgtc
acggacgccaccgttgcggtattcaacgcgcttccggcagacaagctgacgactctgctc
caagagctcatgacggatgcaggcgccaatttcaagctgatgcgccataccatcgcctcc
tcggacctgtctgccgacccggcctacacgtacgacgacaacggcggcaacgtcgacacc
tcgttctcgtctttcaatctgggcgaccgtggcaccgccatggctgaacttcttgccaag
atgaagtctctgcagcccgacctgaccattctcggaagcccgtggagcccgcccgggtgg
atgaagctgaacggtgtgatcgacgggaccacggtcaacaacaatctcaaccacgcctac
gccagccagttcgcccaatacttcgtcaagtacctccaggcctaccagtcgcatggtgtc
accatcgacgccatcaccatccagaacgaacccctgaacagccaagcgggcatgcctacc
atgtatgtctacgccgacgagtctggcaacctgatccagcagaacgtcggcccagcgctg
cgcgccgcgggattcaacacggcaatctgggcgtacgaccataataccgacgtccccagc
tatccgcagaccgtcctgaacgaggcgtctgagtacgtcaacacggtggcctggcactgc
tacgccccgaacaacaactggggagccttgaccaccttccacaacagcaacccgaacgtc
gaccagtacatgacggagtgctggacgtcgacgacgaccgcctggaaccaggcggcggac
ttcaccatggggccgctgcagaactgggccaagggcgcgctggcctggacgctcggcacg
gacaagtccgagggcccgcacctgtccggcagcgggccgtgcaccacctgccgcggcctc
gtcaccatcgacaccagcgccgggacctacaacctcgaggtcgactactacatgatggcc
cagttcagcaagttcatccccaagggcgccatcgtgctcgacggctccggcagctacacc
tactcgggcggcggcggcatccagtccgtcgccaccctgaacccggacggctcgcgcacc
gtcgtgattgagaacacgtttggcaatgccgtgtacgtgactcttaccaccgctggtggg
gagacctggagcgggctggtctacgcgaacagcgtcgtcacctgggtgctcccggcggcg
tcgtaa

DBGET integrated database retrieval system