KEGG   Thielavia terrestris: THITE_2117672Help
Entry
THITE_2117672     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
ttt  Thielavia terrestris
Pathway
ttt04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    THITE_2117672
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THITE_2117672
Peptidases [BR:ttt01002]
 Metallo Peptidases
  Family M67
   THITE_2117672
Membrane trafficking [BR:ttt04131]
 Endosome - Lysosome transport
  Others
   Others
    THITE_2117672
Ubiquitin system [BR:ttt04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    THITE_2117672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: JAB Prok-JAB USP8_dimer
Motif
Other DBs
NCBI-GeneID: 11518350
NCBI-ProteinID: XP_003654570
JGI: Thite2_2117672
UniProt: G2R8H6
Position
3:join(3418204..3418341,3418422..3419785,3419855..3420038)
Genome map
AA seq 561 aa AA seqDB search
MNSTDLSLGSRPMSAKELTEKAKAFDWNPRIGFKYWARAAETIHHEGQVYLREANIPQAY
LVLYRYSVLVLDYLPKHPEAKEPEAKKAVRPLRKRLPRVIGILEALRPDIDEMHQRWVEI
SKVGASDAPHHIPTSPYARHAANDPALAWNYASPANILDASDYQDLAVDLARKEMRRRRR
EAASPEEDIARKRPTYLGDKDAANGRHATQYMDDDELRRQMEETRRQLDRAHDYRSREPD
DVGDVVQPSTYYYPSISRSSPLHYERPPSRDYERPISRGRVEGPRPLPPRPPKEPRADRS
PVRPTPRPRPEREEEYLERSASPLPPPPRPEKEPLPSELLQDLGPGPDGAPVPPPKAPTE
VPRPKRITFRPAAYLENGDPIRPVFLPSALRQRFLRIAEDNTRQGLEMCGMLCGTTVNNA
LFISHLVIPEQRSTSDTCETENESAMLDFCIENDLIVIGWIHTHPTQTCFMSSRDLHTQA
GYQVMMPESIAIVCAPRHEPSWGIFRLTNPPGLPHILSCQRTETFHSHSVDNLYVEAGHP
QGHVYESKTLEFEVCDLRPGH
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaccgacttgagcctgggcagcaggcccatgagcgcaaaagagctgacagag
aaggcgaaggcatttgactggaacccgcgcataggcttcaagtactgggctcgcgccgcc
gaaaccattcatcatgagggtcaagtctacttgcgcgaagcaaacattccccaggcgtac
ctcgttctctatcgctactccgtccttgttctggattaccttcccaaacatcccgaagct
aaggaacccgaggcaaagaaagccgtccgcccactacggaagcgcctcccccgggtaatc
gggattctggaggcgctgcgaccggacattgatgagatgcaccagagatgggttgagatc
tctaaggttggtgcctcggacgcaccacatcacataccgacctcgccctacgcacgacat
gctgcgaacgacccggctctggcctggaactacgcctcgccggcgaacatactcgacgcg
agcgactatcaagatctcgccgtcgatctggccagaaaggaaatgcgcaggcggaggcgc
gaagccgcttcgccagaagaggacatagcacgaaagcgccccacgtatctgggagacaag
gacgccgcaaacgggaggcacgcgacgcaatacatggacgatgatgagcttcggagacaa
atggaggaaacacggcgtcaattagatcgagcacacgattatagaagccgagaacccgat
gacgttggagatgttgttcagccttccacctactactacccatcgatcagcagatcctcg
ccactgcactacgagcgtccaccttcgcgcgactacgagcgtccaatttcgcgcggacgc
gtagaaggcccgagaccactgccgccccgaccgcccaaagaacctcgagccgatcggtcc
cctgtcaggccgacaccgcgaccgcgaccggagagggaggaggagtatcttgagcgatcc
gcctccccgctgccgccgccacctcggccggagaaggagccgttgccttccgagttgctc
caagatcttggaccaggacctgatggcgcacctgtcccccctccgaaagccccaactgag
gtccccaggccaaagagaatcaccttccggcccgccgcctatctcgagaacggtgacccc
atccgacccgtcttcttaccaagcgcattgcggcagcggttcttgcggatcgcggaggac
aacacccgccaagggctcgagatgtgcggcatgctctgcggcaccacggtcaacaacgcg
ctcttcatctcgcacctggtcatccccgagcagagatccacgtctgacacatgcgagacg
gagaacgagtcggccatgctcgatttctgcatcgaaaacgacctgatcgtcatcggctgg
atccacacccacccgacccagacctgtttcatgagctctcgcgacctgcacacccaggcc
ggctaccaggtgatgatgcccgagagcatcgccatcgtgtgcgcgccgcgccacgagccc
tcatggggcatcttccgtctgaccaacccgcccggcctcccgcacatcctctcctgccag
cggaccgagaccttccacagccactcggtcgacaacctctacgtcgaggcagggcacccg
cagggccacgtttatgagtcgaagaccctcgagttcgaagtgtgcgacctgcggccgggg
cattag

DBGET integrated database retrieval system