KEGG   Thielavia terrestris: THITE_2117672Help
Entry
THITE_2117672     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ttt04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(3418204..3418341,3418422..3419785,3419855..3420038)
Genome map
AA seq 561 aa AA seqDB search
MNSTDLSLGSRPMSAKELTEKAKAFDWNPRIGFKYWARAAETIHHEGQVYLREANIPQAY
LVLYRYSVLVLDYLPKHPEAKEPEAKKAVRPLRKRLPRVIGILEALRPDIDEMHQRWVEI
SKVGASDAPHHIPTSPYARHAANDPALAWNYASPANILDASDYQDLAVDLARKEMRRRRR
EAASPEEDIARKRPTYLGDKDAANGRHATQYMDDDELRRQMEETRRQLDRAHDYRSREPD
DVGDVVQPSTYYYPSISRSSPLHYERPPSRDYERPISRGRVEGPRPLPPRPPKEPRADRS
PVRPTPRPRPEREEEYLERSASPLPPPPRPEKEPLPSELLQDLGPGPDGAPVPPPKAPTE
VPRPKRITFRPAAYLENGDPIRPVFLPSALRQRFLRIAEDNTRQGLEMCGMLCGTTVNNA
LFISHLVIPEQRSTSDTCETENESAMLDFCIENDLIVIGWIHTHPTQTCFMSSRDLHTQA
GYQVMMPESIAIVCAPRHEPSWGIFRLTNPPGLPHILSCQRTETFHSHSVDNLYVEAGHP
QGHVYESKTLEFEVCDLRPGH
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaccgacttgagcctgggcagcaggcccatgagcgcaaaagagctgacagag
aaggcgaaggcatttgactggaacccgcgcataggcttcaagtactgggctcgcgccgcc
gaaaccattcatcatgagggtcaagtctacttgcgcgaagcaaacattccccaggcgtac
ctcgttctctatcgctactccgtccttgttctggattaccttcccaaacatcccgaagct
aaggaacccgaggcaaagaaagccgtccgcccactacggaagcgcctcccccgggtaatc
gggattctggaggcgctgcgaccggacattgatgagatgcaccagagatgggttgagatc
tctaaggttggtgcctcggacgcaccacatcacataccgacctcgccctacgcacgacat
gctgcgaacgacccggctctggcctggaactacgcctcgccggcgaacatactcgacgcg
agcgactatcaagatctcgccgtcgatctggccagaaaggaaatgcgcaggcggaggcgc
gaagccgcttcgccagaagaggacatagcacgaaagcgccccacgtatctgggagacaag
gacgccgcaaacgggaggcacgcgacgcaatacatggacgatgatgagcttcggagacaa
atggaggaaacacggcgtcaattagatcgagcacacgattatagaagccgagaacccgat
gacgttggagatgttgttcagccttccacctactactacccatcgatcagcagatcctcg
ccactgcactacgagcgtccaccttcgcgcgactacgagcgtccaatttcgcgcggacgc
gtagaaggcccgagaccactgccgccccgaccgcccaaagaacctcgagccgatcggtcc
cctgtcaggccgacaccgcgaccgcgaccggagagggaggaggagtatcttgagcgatcc
gcctccccgctgccgccgccacctcggccggagaaggagccgttgccttccgagttgctc
caagatcttggaccaggacctgatggcgcacctgtcccccctccgaaagccccaactgag
gtccccaggccaaagagaatcaccttccggcccgccgcctatctcgagaacggtgacccc
atccgacccgtcttcttaccaagcgcattgcggcagcggttcttgcggatcgcggaggac
aacacccgccaagggctcgagatgtgcggcatgctctgcggcaccacggtcaacaacgcg
ctcttcatctcgcacctggtcatccccgagcagagatccacgtctgacacatgcgagacg
gagaacgagtcggccatgctcgatttctgcatcgaaaacgacctgatcgtcatcggctgg
atccacacccacccgacccagacctgtttcatgagctctcgcgacctgcacacccaggcc
ggctaccaggtgatgatgcccgagagcatcgccatcgtgtgcgcgccgcgccacgagccc
tcatggggcatcttccgtctgaccaacccgcccggcctcccgcacatcctctcctgccag
cggaccgagaccttccacagccactcggtcgacaacctctacgtcgaggcagggcacccg
cagggccacgtttatgagtcgaagaccctcgagttcgaagtgtgcgacctgcggccgggg
cattag

DBGET integrated database retrieval system