KEGG   Thielavia terrestris: THITE_2118299Help
Entry
THITE_2118299     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    THITE_2118299
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THITE_2118299
   00640 Propanoate metabolism
    THITE_2118299
  Lipid metabolism
   00061 Fatty acid biosynthesis
    THITE_2118299
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    THITE_2118299
Enzymes [BR:ttt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     THITE_2118299
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     THITE_2118299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(539065..539256,539357..539622,539683..544526,544591..546149)
Genome map
AA seq 2286 aa AA seqDB search
MAETNGHSAPRSGVTVPHVNGSKTYAEKHNLAPHFIGGNRLENAPPSKVKDFVANHDGHT
VITNVLIANNGIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYV
EVPGGTNNHNYANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPG
SAMRSLGDKISSTIVAQHADVPCIPWSGSGVSEVNVDENGIVTVPEHVYLKGCVSSWEEG
LQKAKEIGFPVMVKASEGGGGKGIRKVMSEENFEELYKAAASEIPGSPIFIMKLADSARH
LEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPATFKAMEEAAVRLGKLVGY
VSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDI
RLLYGVDPKTSTEIDFEFKNPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSSGVLHDL
NFRSSSNAWGYFSVGSAGGIHSFSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRT
TVEYLIKLLETEAFEENTITTGWLDELISKKLTAERPDPMLAVVCGAVTKAHIASEQCIA
EYRAGLEKGQVPAKDILKTVFPIDFIYEGFRYKFAVTRSSTDSYRLFINGSKCTVGVRAL
SDGGLLILLSGHSHNVYWKEEAAATRISVDGKTCLLEQENDPTQLRTPSPGKLVKYSVEN
GAHVRAGQTFAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRIKQA
QPFLGQLPEYGTPVIVGNKPSQRFSLLYNTLRDILLGFDNQVIMQSALKELIEVLRDPKL
PYSEFAAQFSALHARMPHRLDAQFTQVLERAAQRQAEFPARSLMKVFQKFIDNLPSKGDA
DLLKSTLAPLTAILDMYADGQKVRELNVISDLLSQYADVERLFSGRRLQDEEVILKLRDQ
HKEDIQKVVQTVLSHSRVSAKNSLVSAILEEYRPNKPNVGNVGKHLRPVLRKLAELESRQ
TAKVSLKAREILIQCALPSLEERKVQMEHILRSSVVESRYGETGWDHREPNLDVIKEVVD
SKYTVVDVLTQFFAHEDPWVTLAALEVYVRRAYRAYILQRIEYHTDEADRPSFLSWDFTL
RKIGQSEFGLPLQSVAPSSPATPVDASFGRISSISDMSYLAHKTQEEPTRKGVIIPCKYL
DDVDELLSKALETLPAPGSMRKKSAGVLADLMDKRRPAPATRLDHSDELSAVVNVAISDA
EGRGDDEVLKEIQPLVQQFKEELLARRVRRVTFICGRKDGSNPAYYTFRGPLYVEDDSIR
HIEPSLAFQLELGRLSKFKIKPVFTENKNIHVYEGIGKDVETDRRFFTRAIIRPGRLRDE
IPTAEYLISEADRVINDIFDALEIIGTSNSDLNHMFINFTPVFQLQPQEVEQSLQGFLDR
FGPRGWRLRVTQVEIRIICSDSAGLPYPLRVIITNTSGYVIQVEMYAERKSEKGEWVFDS
IGGTTKIGSMHLLPVSTPYPTKNWLQPKRYKAHLMGTQYAYDFPELFRQAIQNSWTEAVK
KHPAMAAKQPPVGECIDFSELVLDDQDNLAEVSREPGTNTCGMVGWIIQARTPEYPKGRR
FIVVANDITYNIGSFGPKEDNFFFKCTELARKLGIPRIYLSANSGARLGLANELMPHFKV
AWNDAERPEAGFKYLYLTDEAKHRFENEVITEEITEDGEKRHKIVAIIGAEEGLGVECLR
GSGLIAGVTSRAYNDIFTCTLVTCRSIGIGAYLVRLGQRAVQIEGQPIILTGAQALNNLL
GREVYTSNLQLGGTQIMYRNGVSHLTATDDFAGVSKIVEWMSFVPEKRNGPLPISPSADT
WDRDVVYTPPQKQPYDVRWMIGGKQDEDGFQPGLFDKDSFVETLGGWARTVVVGRARLGG
IPMGVIAVETRTVENITPADPANPDSIEQLTNEAGGVWYPNSAFKTAQAINDFNNGEQLP
LMILANWRGFSGGQRDMYNEVLKYGSFIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPT
INPTVMEMYADVESRGGVLEPEGIIGIKYKKDKQLETMARLDPLYKSLKQSMAREGLSKE
ETDAIKKQMTEREQHLLPVYAQISLQFADLHDRAGRMKAKGVIRQVLEWREARRFFYWRV
RRRINEEYTLKRMAAAVEKAGIHSKDSAQARSRHLQLLKAWTGVPDFEVNDREVAQWYEQ
NHALMQQKLDALSKEAVAAEVQELVRVGTGKDQGIVDSAAWKGVREVLHKMPVEDREKIL
EYLKQV
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgaacggtcacagtgccccgaggagcggcgtcacggttcctcacgttaat
ggcagcaagacgtacgccgaaaagcacaacttggcccctcacttcatcggcggcaacagg
ttggaaaatgctcctccatcaaaagtcaaggatttcgtggccaaccacgacggtcacaca
gtaatcaccaacgtgctgatcgcaaacaatggtatcgccgcggtcaaggaaattcggtca
gtacgcaaatgggcgtacgagacgtttggcgatgagcgggccatcaaatttaccgtaatg
gccaccccagaggatttgcaggcgaacgccgactacatccgcatggcggaccattacgtt
gaggtccctggcggtacaaataaccacaactatgccaacgtcgagctcattgtcgacatc
gccgagcgcatggacgtacatgccgtttgggccggatggggccatgcatccgagaatccg
aagctccccgagtcgctcgccgcgtcacccaaaaaaatcgtcttcattggccctcctggt
tctgctatgcggtctctcggcgacaagatctcctccacaatcgttgctcaacacgcggat
gtgccgtgcattccctggtccggctcaggcgtcagcgaagtcaacgtggacgagaacggc
attgtgacggttcccgagcacgtctacctcaagggttgtgtgagctcttgggaggagggc
ttgcaaaaagccaaagagatcggtttcccggtcatggtcaaggcgtccgaaggcggtggt
ggcaagggtattcggaaggtcatgagcgaggagaactttgaggagctctacaaggccgcc
gccagtgagattcccggctctcccatcttcatcatgaagttggccgacagtgcccgccat
cttgaggtgcaattacttgcagatcagtacggcaacaacatttccctcttcggcagagac
tgttcggtccagcggaggcaccaaaagatcatagaggaagctcccgtcacgatcgccaag
cccgccactttcaaggccatggaggaggccgccgtccgactcggcaagctggttggctac
gtctctgcaggaaccgtcgagtacctctactcccacgccgacgacaagttctacttcctc
gaactgaaccctcgtttgcaagtcgagcaccccaccaccgagatggtcagcggtgtgaac
ctgcccgccgcccaactgcagattgcaatgggtattcctctgcaccgcatccgtgatatc
cggctcctgtatggcgttgaccccaagacgtcaacggagatcgatttcgagttcaaaaac
ccggaaagcgagaagacccagaggcgcccgacgcccaagggccatacgaccgcctgccgt
atcacttccgaagatcctggcgagggcttcaagccgtccagcggtgtgctccatgacctg
aacttccgttcgagctcgaacgcctggggttacttctctgtcggctcggccggcggtatc
cacagtttctccgactcacagttcggtcacatcttcgcctacggcgagaaccgtgcggct
tccaggaaacacatggtggttgccctgaaggagctcagcattcgtggtgatttccgcacc
actgtcgagtacctgatcaagctgctcgagacagaggccttcgaggagaacaccatcacg
accggctggctcgacgagctgatctccaagaagctcaccgccgagcgacccgaccctatg
ttggccgtcgtctgcggtgctgtcacaaaagcgcacattgcgagtgaacaatgcatcgcc
gaataccgtgccggtcttgagaagggacaagtccctgccaaggacatccttaagacggtt
tttccgatcgattttatctacgagggcttccgctacaaattcgccgtcactcgctccagc
actgacagctaccgcctcttcatcaacggctccaagtgcaccgtcggcgtgcgtgccctc
agcgatggcggcctcctcattcttctcagcggccacagccacaacgtctattggaaggag
gaggccgccgccacccgcatttccgtcgacggcaagacatgcttgctggagcaggagaac
gaccccacccagttgcggactccgtcccccgggaagctggtcaagtactccgtcgaaaac
ggtgcccacgtccgggccggccagactttcgccgaggtcgaggtcatgaagatgtatatg
cccctcattgcccaggaagacggcatcgtgcagctcattaagcaacctggcgcaacacta
gaggctggcgatattctcggcatcctcgctcttgatgacccgagccgcatcaagcaggca
cagccattcttgggccagcttcccgagtatggcacgccggtcatcgttggcaacaagccg
tctcaaagattcagtctgctgtacaacaccctccgcgatatcctcctgggcttcgacaac
caggtcattatgcagagcgctctcaaggaactgatcgaagtgctccgcgaccccaagttg
ccgtacagcgaatttgcggcccaattctccgccctccacgcccgtatgccgcaccgactc
gacgcacaattcacccaggtgctggagcgtgcggcgcagcggcaggctgagttcccggcc
cggagtctcatgaaggtgttccagaagttcatcgacaacctcccctcgaagggtgacgcc
gatctgctcaagtccacccttgcccctcttaccgcgattctggacatgtacgccgacggg
caaaaggtccgcgagctcaatgtcatttcggacctgctgtcccagtacgcagacgtcgag
cgcctgttctcgggtcgccgtctccaggacgaagaggtgatcctgaagctccgggaccag
cacaaggaggatatccagaaggtggtgcaaaccgtgctgtcccacagccgagtttcggcc
aagaactcgttggtgtccgcgattctcgaagagtaccggccgaacaagcccaatgttggc
aatgtcggcaagcatctccggcctgtgctccggaagctggcggagctcgagtctcgccaa
actgctaaggtctctctcaaggcgcgcgagatcctcatccagtgtgccctcccctcgctc
gaggagaggaaagtccaaatggagcacatccttcggtcgtcggtcgtcgaatctcgctat
ggtgagaccggctgggatcaccgggagcccaacttggacgtcatcaaggaggtcgtcgat
tccaagtacaccgtggtggacgtgctgacacagtttttcgctcacgaggacccctgggtg
acgctggccgctctcgaggtctacgtccgccgggcttaccgtgcgtacatcctgcagagg
atcgagtaccacaccgacgaggccgataggccttcgttcttgtcgtgggactttacgctc
cgcaagattggccagtctgagtttggcttgccgctccagtcggttgccccttcttctccg
gccacgccggtcgacgccagcttcggccggatcagctccatcagcgacatgtcgtacttg
gcccacaagactcaagaggagcccactcggaagggcgtgatcatcccttgcaagtacctg
gatgacgttgacgagctgttgtcgaaggctctcgagaccctcccggcgccgggaagcatg
cgcaagaagagcgcgggtgttcttgctgatctcatggacaagcgccggccggcgccggct
acccgtctggatcactcggatgaactctccgccgtcgtgaacgtcgctatctccgatgcc
gaaggtcgtggtgacgacgaggtcttgaaggagatccagcccttggtccagcagttcaag
gaggaactccttgcccgccgcgttcgccgtgtcacgttcatctgcggtcgcaaggacggg
tcgaatcccgcctactacaccttcagaggtcccctctacgtcgaggatgacagcattcgc
cacatcgagccgtccctcgccttccagctggagctgggccgtctgtccaagttcaaaatc
aagcccgtgttcactgagaacaagaacatccatgtctacgagggtattggcaaggatgtc
gagaccgacaggcgtttcttcacccgtgccatcatccgtccgggcagacttcgtgatgag
atcccgacggccgagtacttgatctcggaggctgatcgtgttatcaacgacatcttcgat
gcgctcgagatcattggtaccagcaactcggatctcaaccatatgttcattaacttcacc
cccgtcttccagctgcagcctcaggaggtcgagcagtcgctgcaggggttcttggaccgg
ttcgggccgcgtggctggcgcctgcgcgtaacccaggtcgagatccgcattatctgctca
gactcggcaggcctgccttatcccctgcgtgtcatcatcaccaacacttcaggatacgtc
atccaggtggagatgtacgcggagcgcaagtctgagaagggcgagtgggtatttgactcg
atcggcggtactaccaagattggttccatgcacttgcttcctgtctcgacaccttacccg
accaagaactggctgcagcccaagcggtataaggcgcacttgatgggcacccagtacgcc
tacgacttccccgagctcttccgccaggccatccagaacagctggaccgaggccgtgaag
aagcatcctgccatggcggccaagcaaccacccgttggcgagtgcatcgacttcagtgag
ctcgttctggacgaccaggacaacctggccgaggtgtcccgtgagcccggcacgaacacc
tgcgggatggttggctggataatccaagcccgcacgcccgagtaccccaaaggccgcagg
tttatcgtcgtcgccaacgatatcacctacaacatcggctccttcggccccaaggaggac
aacttcttcttcaagtgtacggagctcgcgcgcaagttgggcattccgcggatctacctc
tcggcaaactcgggtgctcgcctgggcctcgccaacgagctgatgccgcatttcaaagtg
gcctggaacgatgccgagaggcccgaggcgggattcaagtacctctacctcacggacgag
gccaagcatcggtttgagaacgaggtcatcactgaggagatcacggaagacggcgagaag
cgccacaagatcgtcgccatcatcggcgcagaagaggggttgggtgtcgagtgcttgcgc
gggtctggcctgattgccggcgtcacaagcagggcttacaacgacatcttcacctgcact
ctcgtcacctgccgctcaatcggtatcggcgcgtaccttgtacgcctcggccagcgtgct
gtgcagattgagggccagcccatcatcctcaccggtgcgcaggcgctcaacaacctgctg
gggcgcgaggtgtacacgtccaaccttcagctcggaggcacccagatcatgtaccgcaac
ggtgtctcccacttaactgcgaccgacgactttgccggcgtctccaagatcgttgaatgg
atgtcgttcgtgcccgagaagcgcaacggaccacttcccatcagcccatctgccgacact
tgggaccgtgacgttgtctacacgccgccgcagaagcagccttacgacgtgaggtggatg
atcggcggcaagcaggacgaggatggtttccagcccggtctctttgacaaggattcgttc
gtcgagaccctcggtggctgggcccgcactgtggtggtgggccgcgcccgcctgggcggt
atccccatgggcgtcattgccgtcgagacacggacggtcgagaacatcaccccggccgac
cccgccaatcccgactcgattgagcagctcaccaacgaggctggcggtgtgtggtacccc
aactcggccttcaagacggcccaggccatcaacgacttcaacaacggcgagcagctcccg
ctcatgatcctggccaactggcgcggcttctcgggcggccaacgcgacatgtacaacgag
gttctcaagtacggctccttcatcgtggatgctcttgtcaagtttgagcagcccgtcttc
atctacatcccgccattcggcgagctccgcggtggctcttgggtcgtcgtggacccgacc
atcaacccgaccgtcatggagatgtatgcagacgtggagtctcgcggcggtgtcctggag
cccgagggcatcatcggcatcaagtacaagaaggacaagcagctcgagacgatggcccgg
ctcgacccgctgtacaagagcctcaagcagtcgatggccagggagggcctgtccaaggag
gagacggacgcgatcaagaagcagatgacggagcgcgagcagcacctgctgcccgtctac
gcgcagatcagcctgcagttcgccgacctgcacgaccgcgccgggcgcatgaaggccaag
ggcgtcatccggcaggtgctcgagtggcgcgaggcccgccgcttcttctactggcgtgtg
cgccggaggatcaacgaggagtacacgctcaagcgcatggcggccgccgtcgagaaggcc
ggcatccacagcaaggactcggcccaggctcgcagccgccacctgcagctgctcaaggcg
tggactggcgtccccgacttcgaggtcaacgaccgcgaggtggcgcagtggtacgaacag
aaccacgccctcatgcagcaaaagctggacgcgctaagcaaagaggccgtcgcggcggag
gtgcaggaactggtgcgcgtgggcaccggcaaagaccagggcatagtggactctgctgcc
tggaagggtgtgcgcgaggtgctgcacaagatgccggtggaggacagggagaagatccta
gaatacctgaagcaggtgtga

DBGET integrated database retrieval system