KEGG   Thielavia terrestris: THITE_2118299Help
Entry
THITE_2118299     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ttt01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ttt00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ttt00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ttt00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:ttt00254]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(539065..539256,539357..539622,539683..544526,544591..546149)
Genome map
AA seq 2286 aa AA seqDB search
MAETNGHSAPRSGVTVPHVNGSKTYAEKHNLAPHFIGGNRLENAPPSKVKDFVANHDGHT
VITNVLIANNGIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYV
EVPGGTNNHNYANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPG
SAMRSLGDKISSTIVAQHADVPCIPWSGSGVSEVNVDENGIVTVPEHVYLKGCVSSWEEG
LQKAKEIGFPVMVKASEGGGGKGIRKVMSEENFEELYKAAASEIPGSPIFIMKLADSARH
LEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPATFKAMEEAAVRLGKLVGY
VSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDI
RLLYGVDPKTSTEIDFEFKNPESEKTQRRPTPKGHTTACRITSEDPGEGFKPSSGVLHDL
NFRSSSNAWGYFSVGSAGGIHSFSDSQFGHIFAYGENRAASRKHMVVALKELSIRGDFRT
TVEYLIKLLETEAFEENTITTGWLDELISKKLTAERPDPMLAVVCGAVTKAHIASEQCIA
EYRAGLEKGQVPAKDILKTVFPIDFIYEGFRYKFAVTRSSTDSYRLFINGSKCTVGVRAL
SDGGLLILLSGHSHNVYWKEEAAATRISVDGKTCLLEQENDPTQLRTPSPGKLVKYSVEN
GAHVRAGQTFAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRIKQA
QPFLGQLPEYGTPVIVGNKPSQRFSLLYNTLRDILLGFDNQVIMQSALKELIEVLRDPKL
PYSEFAAQFSALHARMPHRLDAQFTQVLERAAQRQAEFPARSLMKVFQKFIDNLPSKGDA
DLLKSTLAPLTAILDMYADGQKVRELNVISDLLSQYADVERLFSGRRLQDEEVILKLRDQ
HKEDIQKVVQTVLSHSRVSAKNSLVSAILEEYRPNKPNVGNVGKHLRPVLRKLAELESRQ
TAKVSLKAREILIQCALPSLEERKVQMEHILRSSVVESRYGETGWDHREPNLDVIKEVVD
SKYTVVDVLTQFFAHEDPWVTLAALEVYVRRAYRAYILQRIEYHTDEADRPSFLSWDFTL
RKIGQSEFGLPLQSVAPSSPATPVDASFGRISSISDMSYLAHKTQEEPTRKGVIIPCKYL
DDVDELLSKALETLPAPGSMRKKSAGVLADLMDKRRPAPATRLDHSDELSAVVNVAISDA
EGRGDDEVLKEIQPLVQQFKEELLARRVRRVTFICGRKDGSNPAYYTFRGPLYVEDDSIR
HIEPSLAFQLELGRLSKFKIKPVFTENKNIHVYEGIGKDVETDRRFFTRAIIRPGRLRDE
IPTAEYLISEADRVINDIFDALEIIGTSNSDLNHMFINFTPVFQLQPQEVEQSLQGFLDR
FGPRGWRLRVTQVEIRIICSDSAGLPYPLRVIITNTSGYVIQVEMYAERKSEKGEWVFDS
IGGTTKIGSMHLLPVSTPYPTKNWLQPKRYKAHLMGTQYAYDFPELFRQAIQNSWTEAVK
KHPAMAAKQPPVGECIDFSELVLDDQDNLAEVSREPGTNTCGMVGWIIQARTPEYPKGRR
FIVVANDITYNIGSFGPKEDNFFFKCTELARKLGIPRIYLSANSGARLGLANELMPHFKV
AWNDAERPEAGFKYLYLTDEAKHRFENEVITEEITEDGEKRHKIVAIIGAEEGLGVECLR
GSGLIAGVTSRAYNDIFTCTLVTCRSIGIGAYLVRLGQRAVQIEGQPIILTGAQALNNLL
GREVYTSNLQLGGTQIMYRNGVSHLTATDDFAGVSKIVEWMSFVPEKRNGPLPISPSADT
WDRDVVYTPPQKQPYDVRWMIGGKQDEDGFQPGLFDKDSFVETLGGWARTVVVGRARLGG
IPMGVIAVETRTVENITPADPANPDSIEQLTNEAGGVWYPNSAFKTAQAINDFNNGEQLP
LMILANWRGFSGGQRDMYNEVLKYGSFIVDALVKFEQPVFIYIPPFGELRGGSWVVVDPT
INPTVMEMYADVESRGGVLEPEGIIGIKYKKDKQLETMARLDPLYKSLKQSMAREGLSKE
ETDAIKKQMTEREQHLLPVYAQISLQFADLHDRAGRMKAKGVIRQVLEWREARRFFYWRV
RRRINEEYTLKRMAAAVEKAGIHSKDSAQARSRHLQLLKAWTGVPDFEVNDREVAQWYEQ
NHALMQQKLDALSKEAVAAEVQELVRVGTGKDQGIVDSAAWKGVREVLHKMPVEDREKIL
EYLKQV
NT seq 6861 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgaacggtcacagtgccccgaggagcggcgtcacggttcctcacgttaat
ggcagcaagacgtacgccgaaaagcacaacttggcccctcacttcatcggcggcaacagg
ttggaaaatgctcctccatcaaaagtcaaggatttcgtggccaaccacgacggtcacaca
gtaatcaccaacgtgctgatcgcaaacaatggtatcgccgcggtcaaggaaattcggtca
gtacgcaaatgggcgtacgagacgtttggcgatgagcgggccatcaaatttaccgtaatg
gccaccccagaggatttgcaggcgaacgccgactacatccgcatggcggaccattacgtt
gaggtccctggcggtacaaataaccacaactatgccaacgtcgagctcattgtcgacatc
gccgagcgcatggacgtacatgccgtttgggccggatggggccatgcatccgagaatccg
aagctccccgagtcgctcgccgcgtcacccaaaaaaatcgtcttcattggccctcctggt
tctgctatgcggtctctcggcgacaagatctcctccacaatcgttgctcaacacgcggat
gtgccgtgcattccctggtccggctcaggcgtcagcgaagtcaacgtggacgagaacggc
attgtgacggttcccgagcacgtctacctcaagggttgtgtgagctcttgggaggagggc
ttgcaaaaagccaaagagatcggtttcccggtcatggtcaaggcgtccgaaggcggtggt
ggcaagggtattcggaaggtcatgagcgaggagaactttgaggagctctacaaggccgcc
gccagtgagattcccggctctcccatcttcatcatgaagttggccgacagtgcccgccat
cttgaggtgcaattacttgcagatcagtacggcaacaacatttccctcttcggcagagac
tgttcggtccagcggaggcaccaaaagatcatagaggaagctcccgtcacgatcgccaag
cccgccactttcaaggccatggaggaggccgccgtccgactcggcaagctggttggctac
gtctctgcaggaaccgtcgagtacctctactcccacgccgacgacaagttctacttcctc
gaactgaaccctcgtttgcaagtcgagcaccccaccaccgagatggtcagcggtgtgaac
ctgcccgccgcccaactgcagattgcaatgggtattcctctgcaccgcatccgtgatatc
cggctcctgtatggcgttgaccccaagacgtcaacggagatcgatttcgagttcaaaaac
ccggaaagcgagaagacccagaggcgcccgacgcccaagggccatacgaccgcctgccgt
atcacttccgaagatcctggcgagggcttcaagccgtccagcggtgtgctccatgacctg
aacttccgttcgagctcgaacgcctggggttacttctctgtcggctcggccggcggtatc
cacagtttctccgactcacagttcggtcacatcttcgcctacggcgagaaccgtgcggct
tccaggaaacacatggtggttgccctgaaggagctcagcattcgtggtgatttccgcacc
actgtcgagtacctgatcaagctgctcgagacagaggccttcgaggagaacaccatcacg
accggctggctcgacgagctgatctccaagaagctcaccgccgagcgacccgaccctatg
ttggccgtcgtctgcggtgctgtcacaaaagcgcacattgcgagtgaacaatgcatcgcc
gaataccgtgccggtcttgagaagggacaagtccctgccaaggacatccttaagacggtt
tttccgatcgattttatctacgagggcttccgctacaaattcgccgtcactcgctccagc
actgacagctaccgcctcttcatcaacggctccaagtgcaccgtcggcgtgcgtgccctc
agcgatggcggcctcctcattcttctcagcggccacagccacaacgtctattggaaggag
gaggccgccgccacccgcatttccgtcgacggcaagacatgcttgctggagcaggagaac
gaccccacccagttgcggactccgtcccccgggaagctggtcaagtactccgtcgaaaac
ggtgcccacgtccgggccggccagactttcgccgaggtcgaggtcatgaagatgtatatg
cccctcattgcccaggaagacggcatcgtgcagctcattaagcaacctggcgcaacacta
gaggctggcgatattctcggcatcctcgctcttgatgacccgagccgcatcaagcaggca
cagccattcttgggccagcttcccgagtatggcacgccggtcatcgttggcaacaagccg
tctcaaagattcagtctgctgtacaacaccctccgcgatatcctcctgggcttcgacaac
caggtcattatgcagagcgctctcaaggaactgatcgaagtgctccgcgaccccaagttg
ccgtacagcgaatttgcggcccaattctccgccctccacgcccgtatgccgcaccgactc
gacgcacaattcacccaggtgctggagcgtgcggcgcagcggcaggctgagttcccggcc
cggagtctcatgaaggtgttccagaagttcatcgacaacctcccctcgaagggtgacgcc
gatctgctcaagtccacccttgcccctcttaccgcgattctggacatgtacgccgacggg
caaaaggtccgcgagctcaatgtcatttcggacctgctgtcccagtacgcagacgtcgag
cgcctgttctcgggtcgccgtctccaggacgaagaggtgatcctgaagctccgggaccag
cacaaggaggatatccagaaggtggtgcaaaccgtgctgtcccacagccgagtttcggcc
aagaactcgttggtgtccgcgattctcgaagagtaccggccgaacaagcccaatgttggc
aatgtcggcaagcatctccggcctgtgctccggaagctggcggagctcgagtctcgccaa
actgctaaggtctctctcaaggcgcgcgagatcctcatccagtgtgccctcccctcgctc
gaggagaggaaagtccaaatggagcacatccttcggtcgtcggtcgtcgaatctcgctat
ggtgagaccggctgggatcaccgggagcccaacttggacgtcatcaaggaggtcgtcgat
tccaagtacaccgtggtggacgtgctgacacagtttttcgctcacgaggacccctgggtg
acgctggccgctctcgaggtctacgtccgccgggcttaccgtgcgtacatcctgcagagg
atcgagtaccacaccgacgaggccgataggccttcgttcttgtcgtgggactttacgctc
cgcaagattggccagtctgagtttggcttgccgctccagtcggttgccccttcttctccg
gccacgccggtcgacgccagcttcggccggatcagctccatcagcgacatgtcgtacttg
gcccacaagactcaagaggagcccactcggaagggcgtgatcatcccttgcaagtacctg
gatgacgttgacgagctgttgtcgaaggctctcgagaccctcccggcgccgggaagcatg
cgcaagaagagcgcgggtgttcttgctgatctcatggacaagcgccggccggcgccggct
acccgtctggatcactcggatgaactctccgccgtcgtgaacgtcgctatctccgatgcc
gaaggtcgtggtgacgacgaggtcttgaaggagatccagcccttggtccagcagttcaag
gaggaactccttgcccgccgcgttcgccgtgtcacgttcatctgcggtcgcaaggacggg
tcgaatcccgcctactacaccttcagaggtcccctctacgtcgaggatgacagcattcgc
cacatcgagccgtccctcgccttccagctggagctgggccgtctgtccaagttcaaaatc
aagcccgtgttcactgagaacaagaacatccatgtctacgagggtattggcaaggatgtc
gagaccgacaggcgtttcttcacccgtgccatcatccgtccgggcagacttcgtgatgag
atcccgacggccgagtacttgatctcggaggctgatcgtgttatcaacgacatcttcgat
gcgctcgagatcattggtaccagcaactcggatctcaaccatatgttcattaacttcacc
cccgtcttccagctgcagcctcaggaggtcgagcagtcgctgcaggggttcttggaccgg
ttcgggccgcgtggctggcgcctgcgcgtaacccaggtcgagatccgcattatctgctca
gactcggcaggcctgccttatcccctgcgtgtcatcatcaccaacacttcaggatacgtc
atccaggtggagatgtacgcggagcgcaagtctgagaagggcgagtgggtatttgactcg
atcggcggtactaccaagattggttccatgcacttgcttcctgtctcgacaccttacccg
accaagaactggctgcagcccaagcggtataaggcgcacttgatgggcacccagtacgcc
tacgacttccccgagctcttccgccaggccatccagaacagctggaccgaggccgtgaag
aagcatcctgccatggcggccaagcaaccacccgttggcgagtgcatcgacttcagtgag
ctcgttctggacgaccaggacaacctggccgaggtgtcccgtgagcccggcacgaacacc
tgcgggatggttggctggataatccaagcccgcacgcccgagtaccccaaaggccgcagg
tttatcgtcgtcgccaacgatatcacctacaacatcggctccttcggccccaaggaggac
aacttcttcttcaagtgtacggagctcgcgcgcaagttgggcattccgcggatctacctc
tcggcaaactcgggtgctcgcctgggcctcgccaacgagctgatgccgcatttcaaagtg
gcctggaacgatgccgagaggcccgaggcgggattcaagtacctctacctcacggacgag
gccaagcatcggtttgagaacgaggtcatcactgaggagatcacggaagacggcgagaag
cgccacaagatcgtcgccatcatcggcgcagaagaggggttgggtgtcgagtgcttgcgc
gggtctggcctgattgccggcgtcacaagcagggcttacaacgacatcttcacctgcact
ctcgtcacctgccgctcaatcggtatcggcgcgtaccttgtacgcctcggccagcgtgct
gtgcagattgagggccagcccatcatcctcaccggtgcgcaggcgctcaacaacctgctg
gggcgcgaggtgtacacgtccaaccttcagctcggaggcacccagatcatgtaccgcaac
ggtgtctcccacttaactgcgaccgacgactttgccggcgtctccaagatcgttgaatgg
atgtcgttcgtgcccgagaagcgcaacggaccacttcccatcagcccatctgccgacact
tgggaccgtgacgttgtctacacgccgccgcagaagcagccttacgacgtgaggtggatg
atcggcggcaagcaggacgaggatggtttccagcccggtctctttgacaaggattcgttc
gtcgagaccctcggtggctgggcccgcactgtggtggtgggccgcgcccgcctgggcggt
atccccatgggcgtcattgccgtcgagacacggacggtcgagaacatcaccccggccgac
cccgccaatcccgactcgattgagcagctcaccaacgaggctggcggtgtgtggtacccc
aactcggccttcaagacggcccaggccatcaacgacttcaacaacggcgagcagctcccg
ctcatgatcctggccaactggcgcggcttctcgggcggccaacgcgacatgtacaacgag
gttctcaagtacggctccttcatcgtggatgctcttgtcaagtttgagcagcccgtcttc
atctacatcccgccattcggcgagctccgcggtggctcttgggtcgtcgtggacccgacc
atcaacccgaccgtcatggagatgtatgcagacgtggagtctcgcggcggtgtcctggag
cccgagggcatcatcggcatcaagtacaagaaggacaagcagctcgagacgatggcccgg
ctcgacccgctgtacaagagcctcaagcagtcgatggccagggagggcctgtccaaggag
gagacggacgcgatcaagaagcagatgacggagcgcgagcagcacctgctgcccgtctac
gcgcagatcagcctgcagttcgccgacctgcacgaccgcgccgggcgcatgaaggccaag
ggcgtcatccggcaggtgctcgagtggcgcgaggcccgccgcttcttctactggcgtgtg
cgccggaggatcaacgaggagtacacgctcaagcgcatggcggccgccgtcgagaaggcc
ggcatccacagcaaggactcggcccaggctcgcagccgccacctgcagctgctcaaggcg
tggactggcgtccccgacttcgaggtcaacgaccgcgaggtggcgcagtggtacgaacag
aaccacgccctcatgcagcaaaagctggacgcgctaagcaaagaggccgtcgcggcggag
gtgcaggaactggtgcgcgtgggcaccggcaaagaccagggcatagtggactctgctgcc
tggaagggtgtgcgcgaggtgctgcacaagatgccggtggaggacagggagaagatccta
gaatacctgaagcaggtgtga

DBGET integrated database retrieval system