KEGG   Thielavia terrestris: THITE_2118632Help
Entry
THITE_2118632     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ttt  Thielavia terrestris
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ttt00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1205678..1206499,1206563..1208154,1208262..1208643))
Genome map
AA seq 931 aa AA seqDB search
MEGGTADAPRREEWSKPNGVRLKREDSSGSATPNGSKINSRASSTSPDDAKSAGASISPP
ENGPLPKLSRKASQRMPSSPPPLFDHLPDATQEACSTFQVINDCLYGSRNMGSSDHDALD
CDCAEDWRDDRNHACGEDSDCINRATKIECVDGECNCGDGCQNQRFQRKQYAKVSVIKTE
KKGFGLRADTDLQPNDFVYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLTKNEFVDAT
KKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAGRRIRAGEELVFNYNVDRYGADPQPC
YCGEPNCVGFIGGKTQTERATKLPLATIEALGIDDGDNWDTTVAKRPRKKKAHEDDEEYV
NSLQPRALDEDGVNKVMATLMQCKEKWIAVKLLSRLQATEDDHLRHRVVRMHGYQILKST
LNTFKDDTNVVLQILDILYQLPRITRNKISDSNIEAAVQPLASAAHEGVAAAAQRLLDEW
SKLETAYRIPRKKHDHTAPTTVNSFEEERRNKDRDEPAKPAADPFANVVIPTGPRSNIPQ
RNANYFNGQRPRKLPTNLPAGWFVTTDKTGRYYFYDVNGRTQWQRPTMPAIETPKASAKA
QQDQKALQSIIDSLTKEPTPRRSAGHTPQRSSTPTADPKKEKWRSLPIEKQMKIYENTLF
PHVKHVMDKFHGKLPKEDLKKFAREVNKKLVASDYKNNRVEDPTSISSKLAKKVRNYVQD
FFERALVKYTEHEKRKAQRAAAASSRPDGGAGAGPAATPVKDGDEAMSDVEGASSPGSSA
GRKRKRDDEDLVESPEEGGAPPSETPSAKRAREDEPAAVPSPPSPPPPPADTPLTEEERS
MREQEEALMRENEEAQRLEDEALAQMDGAKKQDASGVAAARANGLMTTAAAGAAGRGVGA
SPSPEDVVSSMDVDAQPPQQQQKQQQVVLSH
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggagggaggcacggcggatgcaccgagacgggaggagtggtcaaaacccaacggagtc
aggttaaaacgggaggactcgagcggctcggccaccccgaacgggtccaaaatcaactca
cgggcgtccagcacgtcgcccgacgacgcgaaatctgccggcgccagcatatcaccgccc
gaaaatggcccgctaccgaagctatcacgaaaagcgtcccaaagaatgccctcgagcccg
cctccattgttcgaccatctgccggacgccactcaggaagcatgcagcacatttcaggtg
atcaacgattgtctctatggctcgcggaacatggggtcatcagaccatgacgctctggat
tgtgactgcgctgaagattggcgtgacgaccgtaatcacgcctgcggtgaggactcagac
tgcatcaaccgggcgaccaagatcgagtgcgtagacggcgaatgcaactgcggcgatggc
tgccaaaaccagcggtttcagcgcaagcagtatgccaaggtctcggtcatcaagacggag
aagaagggctttggcctgcgggcggacactgacctgcagcccaatgactttgtgtacgag
tacgtcggcgaggtcatcaacgagcccaccttccgcagccgcatgctgaagtacgacaag
gagggcatcaagcacttctactttatgtcgctgaccaagaacgagttcgtggatgcgacc
aaaaagggcaacctcggcaggttttgcaatcactcgtgcaatcccaactgctatgtggac
aagtgggtggtgggcgaaaagctgcgcatgggtattttcgccggccgcaggatccgcgcc
ggcgaggagctggtgttcaactacaacgtggaccgctatggcgccgacccgcagccgtgc
tactgtggcgagccaaactgcgtcggctttatcggcggcaagacgcagacagaacgcgca
accaaactgccgcttgcaaccattgaggcgctcggcatcgacgatggcgacaactgggac
acgacggtcgccaagaggccgcgcaagaagaaggcgcacgaggacgacgaggaatatgtc
aacagccttcagccccgtgcgctcgacgaggacggcgtcaacaaggtcatggctacgctc
atgcagtgcaaggagaagtggattgccgtcaagctgctctcccgactccaggcgaccgag
gatgaccatcttcgccatagggtggtgaggatgcacggctaccaaatcctgaaaagcacc
ttgaacacattcaaggacgacaccaacgtggttctgcaaatcctggacattttataccag
cttccgcggatcacgcgaaacaagatctcggattcgaacatcgaggcggcggtgcagccg
ctcgcatcggccgcgcacgaaggggtcgctgctgccgcccagcggttgctcgacgagtgg
agcaaattggagaccgcctaccgcatcccgcgcaagaagcacgaccatacggcgccaaca
acagtcaattcattcgaggaggagcggcgcaacaaggaccgcgacgagccggccaagccc
gcggcggatcctttcgccaacgtggtcatcccgaccggaccgcgtagcaacatcccgcag
cggaatgcgaattacttcaacgggcagcgcccccggaagttgcccaccaatctgcccgcc
gggtggtttgtcaccaccgacaagaccgggcgatactacttttacgatgtgaacggtagg
acgcaatggcagcgtcccaccatgcctgccatcgagaccccgaaggcgtctgcgaaggca
cagcaggaccaaaaagcgctgcagagcatcatcgacagcctgaccaaagagccgacgcct
cggcgttcggcaggccacacaccacagcggtccagcacgcctacggcggaccccaaaaag
gaaaagtggcgttctctgccgatcgagaagcagatgaagatctacgagaacacgcttttc
cctcatgtcaagcacgtcatggacaagttccacggcaaactcccaaaggaggacttgaag
aagttcgcacgtgaggtcaacaagaaacttgtcgcctcggactacaagaacaaccgcgtt
gaggacccgacctccatctcctccaagctggcaaaaaaggtgcgaaactacgtccaagac
ttcttcgagcgcgccttggtgaaatacaccgagcacgagaagaggaaggcccagagggcc
gctgctgcatcgtcccggccagacggaggggccggcgcgggtccagccgccacaccggtc
aaggacggcgacgaagccatgtctgacgtcgaaggcgccagcagccccggcagctcggcg
gggcgcaagcgcaagcgcgacgacgaggacctcgtcgaatcgcccgaggagggaggggcg
cccccgtccgagacgccgtcggcgaaacgagcgagagaggacgagcccgccgccgtcccg
agcccgcccagcccgccgcccccgccggccgacacgccgctgaccgaggaggagcggtcg
atgcgcgagcaggaggaggcgctcatgcgcgagaacgaggaggcccagcggctggaggac
gaagcgctggcccagatggacggggcgaagaagcaagacgccagtggcgtggccgcggcg
cgggcgaatgggttgatgacgacggccgccgccggcgccgccggcaggggagtcggtgct
tctccgtcaccggaagacgtcgtctcttcgatggatgttgatgcgcagccaccacagcag
cagcagaagcagcagcaggtggtgctgagccactga

DBGET integrated database retrieval system