KEGG   Thielavia terrestris: THITE_2118655Help
Entry
THITE_2118655     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ttt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttt00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttt00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ttt00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1246237..1246265,1246339..1246956,1247048..1247118,1247226..1247263))
Genome map
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKSIIENLNKASLDPNVEVVIAPPALYLQLARDTVDKASGV
EVAAQNVYHKPNGAYTGEISVAQLKDSDIHWTILGHSERRTLLGETDELVASKTKAAVEG
GVSVIWCCGESLEEREAGNTVAVVERQLAALAAKLSAADWKKIVIAYEPIWAIGTGKVAT
VQQAQEVHEAIRKWLRTQFGDAVADETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLK
PEFVDIINSNQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgttggcggcaacttcaagatgaacgggaccaaggagtccatc
aagagcatcattgagaacttgaacaaggccagcttggatcccaacgtcgaggtcgtgatc
gcccccccagcgctgtacctccagctcgcgcgggacacggtcgacaaggcgtccggcgtc
gaggtggcggcgcagaacgtctaccacaagcccaacggcgcctacacgggcgagatcagc
gtggcccaactcaaggacagcgacatccactggaccatcctgggccactcggagcggcgg
acgctgctgggcgagacggacgagctggtggcgtccaagaccaaggccgccgtcgagggc
ggcgtcagcgtcatctggtgctgcggcgagtcgctcgaggagcgcgaggccggcaacacg
gtcgcggtcgtcgagcgccagctggccgccctcgccgccaagctctcggccgccgactgg
aagaagatcgtgatcgcctacgagcccatctgggccatcggcaccggcaaggtcgccacc
gtccagcaggcccaggaggtgcacgaggccatccgcaagtggctcaggacccagttcggc
gacgcggtcgccgacgagacccggatcctctacggtggcagcgtcaacggcaagaactgc
aaggaccttgccaaggagaaggacattgacggtttcctggttggcggtgccagcctgaag
cccgagttcgtcgacatcatcaactccaaccagtga

DBGET integrated database retrieval system