KEGG   Thielavia terrestris: THITE_2118655Help
Entry
THITE_2118655     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2118655
   01230 Biosynthesis of amino acids
    THITE_2118655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2118655
   00051 Fructose and mannose metabolism
    THITE_2118655
   00562 Inositol phosphate metabolism
    THITE_2118655
Enzymes [BR:ttt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THITE_2118655
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   THITE_2118655
  Exosomal proteins of bladder cancer cells
   THITE_2118655
  Exosomal proteins of melanoma cells
   THITE_2118655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1246237..1246265,1246339..1246956,1247048..1247118,1247226..1247263))
Genome map
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKSIIENLNKASLDPNVEVVIAPPALYLQLARDTVDKASGV
EVAAQNVYHKPNGAYTGEISVAQLKDSDIHWTILGHSERRTLLGETDELVASKTKAAVEG
GVSVIWCCGESLEEREAGNTVAVVERQLAALAAKLSAADWKKIVIAYEPIWAIGTGKVAT
VQQAQEVHEAIRKWLRTQFGDAVADETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLK
PEFVDIINSNQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgttggcggcaacttcaagatgaacgggaccaaggagtccatc
aagagcatcattgagaacttgaacaaggccagcttggatcccaacgtcgaggtcgtgatc
gcccccccagcgctgtacctccagctcgcgcgggacacggtcgacaaggcgtccggcgtc
gaggtggcggcgcagaacgtctaccacaagcccaacggcgcctacacgggcgagatcagc
gtggcccaactcaaggacagcgacatccactggaccatcctgggccactcggagcggcgg
acgctgctgggcgagacggacgagctggtggcgtccaagaccaaggccgccgtcgagggc
ggcgtcagcgtcatctggtgctgcggcgagtcgctcgaggagcgcgaggccggcaacacg
gtcgcggtcgtcgagcgccagctggccgccctcgccgccaagctctcggccgccgactgg
aagaagatcgtgatcgcctacgagcccatctgggccatcggcaccggcaaggtcgccacc
gtccagcaggcccaggaggtgcacgaggccatccgcaagtggctcaggacccagttcggc
gacgcggtcgccgacgagacccggatcctctacggtggcagcgtcaacggcaagaactgc
aaggaccttgccaaggagaaggacattgacggtttcctggttggcggtgccagcctgaag
cccgagttcgtcgacatcatcaactccaaccagtga

DBGET integrated database retrieval system