KEGG   Thielavia terrestris: THITE_2118715Help
Entry
THITE_2118715     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2118715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1347343..1347402,1347508..1351880,1351958..1352587,1352656..1352839))
Genome map
AA seq 1748 aa AA seqDB search
MSELRALEALQAMHGELVAVRQHRYEGLPVLEQLLDAQTDAFRKLVDKPPRNSADRTKLS
EGKVKIGDEEYAINDDFANECLKVADELDLNELESARILLDCDAEGDPETQSRPLWECGV
IRFHQERRYLLDCMRLCLEIAADDELEPGLQDAFGAVAEEKVFGIPPPGSQPELGAKKVV
PRCMEAMQSVRSMLQSMLDKAAARNVLQQASLVRPPEIQETFDFSRASLVEQHECLAAIL
HAAVERRHATVGDFQEFLKTLQKVDKYDHFLVHLFPVLAAYITVFGSTEGMGDLQQARQL
NQLVCKQGDDDSWVMPNLRAAVRAWWIAEHSGWYLDDTTYDLEGINLDEEDDERNKQFTE
ALKEGAFDFILSVAADCKAQEWQDPSRLGMRQWIQRKCPPLASDPFPFSHFLQQSLMVHL
EGFIDAAISNLPDMLRKLRTEEDEQRQLSQNHEQDLDLERFLIIISYAYEGRPDAAMSFW
EDPDSNLAGFLQWASRRASTPLVSAFCEMLVCLSDSEECATAAHAFLLDEGHQASGKMKR
SQSLTWSQIFKELNYFTKRLGEGSTQAQAHMVQRSGKPGADLTETEPESVLMLECYLRLI
AKLVSESEVARQRMILDGDLPLVDTMFKLLAVRIPRRLRAGVFYVLKAVMTRRQASENEV
LWKFIDEFTTGTLPNQLGLAQRISYLGQPVSPQVYMETALRDVSDDFEESNAFIQLLTSL
FAPLEDSEGLNDSLTFPENLGSSVRVPGMEPYVDFVFRVFADKPQDLVDPAQCRALRVSA
LEFALTCLSTFNEDLIILGNESNIAIDIAMPTTDLATYVRLHPFARVMEWLFNEKVIAAL
IRTIHQDPSDLGSASPDSPLVLSILRGIQVMIKALDLQDTYLHLVRPLIEAQSGQRRASV
ANSAYASFEDGILSHLSLVVDLGKYCNLGHGELTLACLKLLEKISTSPRIIAAWNPETGR
LGHRNKAIVQLERNGEGQTIAASLSAILSATLDPVLEAESENYVIKLFILDFLYECLKAT
PDQPTIAHLLLGFHCELNQLTIEPRGAFDAQKSLFHSLLNVIIGLSVYEEEHGMRGYLIT
LKYRILRILQVLWKSPLSATLVMDELRSTNFMFHMLLKEVQIQPALRWDDLEANNPEFLL
SNASVAYIDYLGARAMIFEYIGKELCSVSQNRIPSIKRQIFDALNGQINIDGQEPLTLGN
VFDFFDFLNPDANWDVPPPQFVFYKDLDLRPCAVEHPEAGLQYNIHKVREIISLKRNELR
DTLQVASQQDLDAIETEEGVLVEYLTFTNRQKLFNASRLALLRSWANVLLVMFEARDFKG
TPKMAFLLQALQAILPTLEAYSTPSPAEAFELARVAKELLFKLDLSEDDDNTVTGLDKER
FTVGNLISDKLFQLFQICLNSIGKWAGSAELRALYYSICYRYLTAVVDRDATTSSGSSTR
NLAAVRLKALKAVHLHGDRLLNVICDDAYGSDPACQTAAMVLLSALVHTSRATDEDAAII
ESLNRLNFIGVLVDSLKTILTDWLAASSTTTSQRPLLPNDLRATIYPSPPAAALDTERYT
AAKLALLLQIAQTRQGAKYVVQANLFRALEHAAVFAADPELQVPPVSARAADDGGYDAAR
ALARHYALLVALARIVAAAVLARGAHNVVQGRRFLTQHRMLVVHTLKRSAGIGGVGSAAP
AGAWSSLENGTPAGARRALEAQAQAELQERIEELAEAFMLLITATGFLEFEAGQVPAEKP
RVNTTIFH
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactgcgcgcgctcgaggccctccaggccatgcacggagagctagtcgccgtc
cgccagcatagatatgagggcttgccggtgctggagcagctcctcgacgcgcaaaccgat
gctttcaggaagctggtcgacaagccgccgcgaaactcggcggacagaacaaaattgagc
gaaggaaaagtcaagatcggcgacgaggagtacgcgattaacgacgatttcgccaacgag
tgcctcaaagtcgccgacgagctggatctaaacgaactcgagtcggccaggatcctgctc
gactgcgacgccgagggcgaccccgagacgcagagtcgcccactgtgggaatgcggcgtc
atccgattccaccaggagcgcaggtatctgctcgactgcatgcgcctttgcctcgagatt
gccgccgacgatgagctggagccaggactgcaggacgcgtttggcgccgtggccgaggag
aaggttttcggtatccccccgccggggtcgcagccagagttgggtgccaaaaaggtggtt
ccgagatgcatggaggctatgcagagcgtcaggtctatgctccaaagcatgctggacaaa
gcggctgctcggaacgtgctacagcaggccagtcttgtgaggccgccggagattcaagaa
acattcgatttctcgcgggcgagcctcgttgaacaacatgagtgtttggccgcgatcctc
cacgctgccgtcgagaggcgtcacgccaccgtgggcgacttccaggagttcctcaagacc
ctccagaaggtcgacaagtacgaccacttcctcgtccacctgtttccggttcttgcggca
tacatcacggtgttcggatcgaccgaggggatgggcgacctccagcaagcgcgccagctg
aatcagcttgtctgcaagcaaggcgacgatgattcctgggtcatgccgaacttgcgtgcc
gcggttagggcgtggtggattgctgagcacagcggatggtacctggacgacacaacctac
gacctcgaggggatcaacttggatgaggaggacgacgagcggaacaagcagttcacagag
gcgttgaaggagggcgcgttcgacttcatcttgtccgtcgccgccgactgcaaggcccag
gaatggcaggacccatcacggctgggcatgcgccaatggatccagcggaagtgccctcct
ctggcatccgaccccttccccttcagtcacttcctccaacagagcctgatggtgcacctg
gagggctttatcgatgccgccatctccaacctcccagatatgctgaggaaactgaggacc
gaggaggacgagcaacgccagctcagccaaaaccacgaacaggatctcgacctggagcgc
ttcctcatcatcatttcgtatgcctacgaaggcagaccggacgccgccatgtcgttttgg
gaagaccccgatagcaatcttgccggcttcttgcaatgggcctcgagacgggcgtccact
ccgctcgtcagcgcgttttgcgaaatgcttgtttgcctgtctgacagtgaggagtgcgcc
acggcggcccacgccttcctcctggacgaaggccaccaagcttcgggcaaaatgaagcgc
tcccaatccctgacgtggtcccagattttcaaggagctgaattacttcacaaagaggctc
ggcgaggggtcaacgcaggcccaggcgcacatggtgcaacgctccggcaaacccggcgct
gatctgaccgagaccgagcccgagtcagtcttgatgcttgagtgttatttgcgtctgata
gcgaagctggtgtcggagagcgaggtcgccaggcagagaatgattctggatggcgacttg
ccacttgtcgacacaatgttcaagctccttgctgtcagaattccccgtcggcttcgggct
ggcgtcttctacgttctgaaagccgtgatgacgaggaggcaggcttccgagaacgaggtg
ttgtggaaattcattgacgagttcacgaccggcacgcttcccaatcaactcggacttgcg
caacgaatttcgtatctcggccagcccgtgagcccgcaggtatacatggagacagctctg
agggatgtgagcgatgacttcgaggagtcgaatgcctttatccagctgctcacctctctt
ttcgccccgctcgaggactccgaaggactgaacgactccttgaccttcccggaaaacttg
gggagcagtgtgcgcgttcccggcatggaaccctatgtcgactttgtcttccgggttttc
gccgacaagccccaagacctcgtcgatcccgcgcaatgcagggcgttgcgcgttagcgct
ctcgaatttgccctcacatgcttgtcaaccttcaacgaggacctaatcattctgggcaac
gagagcaatatcgccatcgacattgctatgccgacgacggacctggccacttacgtgcgc
ctccatccgttcgcccgcgtcatggagtggctgttcaacgaaaaggtcatcgccgccctg
attcggaccatccatcaggaccccagcgatctgggcagtgcgtccccggactcgcctctg
gtgctgagcattttgcggggaatccaggtcatgatcaaggcgctcgatctccaagacacc
tacctgcatctagtccggcctctgatcgaagcgcagtctggacagcggcgagccagcgtg
gcaaattctgcctatgcctccttcgaggacggcatcctcagccatctgtctctggtggtc
gatctgggcaagtactgcaaccttggccacggcgagctgacgctcgcgtgcctgaagttg
ctcgaaaagatctcgacatcgcctaggatcattgcggcgtggaatccggaaaccggtcgg
ctcggccaccgaaacaaggcgatcgtccagctcgagaggaacggcgagggccagaccatt
gccgcttctctgtctgctatcctatcagccaccctagaccctgtcctggaggccgagtcg
gagaactatgtcatcaagctgtttattctcgatttcctctacgagtgcctcaaggcgacg
ccggaccaaccaaccatcgcccacttgctcctaggcttccactgcgagcttaaccagctc
accattgagcccagaggtgccttcgacgcgcagaaatctctgttccacagtctgctcaac
gtcatcatcgggctctcggtgtacgaagaggagcatggcatgcgagggtatctcatcacc
ttgaaataccgaattctgcggattttacaggttctgtggaagtcgccgctctcagcaact
ctggtcatggacgagttgaggtcaaccaacttcatgttccacatgctgctgaaggaggtt
cagatccagccagctctgcggtgggatgacttggaggcgaataaccccgagttcctgctc
tccaatgcctccgtggcgtacatcgactatctcggcgcgcgggccatgattttcgagtac
atcggcaaggagctctgcagcgtttcccaaaaccgaataccctcgattaagcggcaaata
ttcgacgccctgaacggccagatcaatatcgatggccaggaaccgctgaccctcggaaac
gtctttgacttctttgatttcttgaatcccgatgccaactgggacgtccctccgccgcag
ttcgtcttctacaaggatctcgacctccggccatgtgccgtcgagcaccccgaggcgggc
ttgcaatacaacatccacaaagtgcgggaaatcatttctctgaagcggaacgagctcagg
gatacgctccaggtggcttcccagcaggacttggacgccatcgaaacagaggagggcgtg
ttggtcgagtacttgaccttcactaaccgccagaagctgttcaatgcatcgaggctcgcc
ctgctgagatcgtgggcgaacgtgctgctcgtgatgttcgaggcccgcgactttaagggt
acacccaagatggccttcctgctgcaagctctgcaagccattcttccgaccctcgaggcc
tacagcaccccgagtcctgccgaggcgttcgagcttgcaagagtcgccaaggagctgctc
ttcaaactcgacttgtcggaggacgacgacaacaccgtcaccggcctggacaaggagaga
ttcacggtgggcaacctcatcagcgacaagctcttccagctcttccagatctgcctcaac
tcgatcggcaagtgggccggcagcgccgagctccgtgcgttatactacagcatctgctac
cgctatctcaccgccgtcgtcgacagggacgccacgaccagtagcggcagcagcactcgc
aacctcgcagcagtccgcctgaaggcccttaaggcggtccaccttcacggcgaccgcctc
ctcaacgtgatctgcgacgacgcctacggcagcgacccggcctgccaaaccgccgccatg
gtacttctcagcgcgctcgtgcacacgtcccgcgcgaccgacgaagacgcggccatcatc
gagtcgctcaaccgcctcaacttcatcggcgtgctcgtcgactcgctcaagacgatcctc
accgactggctcgccgccagctccaccaccacctcgcagcgccctttattacccaacgat
cttcgcgccaccatctaccccagcccgcccgccgccgccctcgacacggagcggtacacg
gccgccaagctggccctgctcctgcagatcgcgcagacccgccagggcgccaagtacgtc
gtgcaggcgaacctgttccgcgcgctcgagcacgccgccgtgttcgccgccgacccggag
ctgcaggtgcctcccgtcagcgcgcgcgcggccgacgacggcggctacgacgcggcgcgc
gccctggccaggcactacgcgctgctggtggcgctggcgcgcatcgtcgccgccgccgtg
ctcgcgcgcggcgcccacaacgtcgtccagggccgccgcttcctgacccagcaccgcatg
ctggtcgtgcacacgctgaagcggagcgcggggatcggcggtgtggggtcggcggcgccg
gcgggggcgtggtcatcactagagaacggtacgccggcgggggcgaggagggccctggag
gcgcaggcgcaggctgagttgcaggagaggattgaggagttggccgaggcgtttatgttg
ctgattaccgcgacggggtttttggagttcgaggcgggccaggtccctgctgagaagccg
agagtgaacacgacgatcttccactga

DBGET integrated database retrieval system