KEGG   Thielavia terrestris: THITE_2118901Help
Entry
THITE_2118901     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ttt  Thielavia terrestris
Pathway
ttt04111  Cell cycle - yeast
ttt04113  Meiosis - yeast
ttt04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    THITE_2118901
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    THITE_2118901
   04113 Meiosis - yeast
    THITE_2118901
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     THITE_2118901
Ubiquitin system [BR:ttt04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     THITE_2118901
Chromosome and associated proteins [BR:ttt03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    THITE_2118901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_14 TPR_16 TPR_12 TPR_7 TPR_19 TPR_17 TPR_11 TPR_6 TPR_9 TPR_15 DUF2225
Motif
Other DBs
NCBI-GeneID: 11524327
NCBI-ProteinID: XP_003655324
JGI: Thite2_2118901
UniProt: G2RB17
Position
4:join(1639680..1642046,1642118..1642192)
Genome map
AA seq 813 aa AA seqDB search
MAPTSAAIAGLLKQTVYYHLDNLSYQNAVFFAERLHAHDQRSHESGFLLALSHFRLGDSR
SAYEISKPSAFRGAHLGCSFVFAQSCLDLERYKEGITALEKARPLWTAKCSVGRHTASAR
APYPDAAAVSCLLGKLYRAYDDKKRAIPCFEDALRANPFMWDAFTILCDMGVNVMVPNIF
KLNDNFARSFDQEPGAISVDSSGGQPEPLQRKTGLQVVGQDSDPFEGHRSTAFQDVSSNN
MLFVDTEENDLTFKLIPAPRYPSSKHGHDGAETPTGPTVAPDAQAPRFGLPSEPPLAPTR
RTRAAQAVEPNLFDAAPPKMSYRLGSKRRDRGQDQIADPPEAAARGPAPALSTTERKRTA
SGHPVQPRSTNGEEPRRSARLNVAPRTTSSRANSGVAAIGANPPRELRKARPPISRIARP
GSSGTGVGRVVSGNRKPLEENNSMDIDQAEASRVKEQAAVQAPPPKPAEPELVKADEGLR
WILDFLKKIASGYRLSSQFRCQEALTAFMALPRSHQDTPWVTARIARAHYELANYAEAEK
YFKRLRMLAPTRHEDMEVFSTVLWQLRKETELSFLAHELVDAVWDSPQAWCALGNAFSLA
SDHEQALKCFRRAILLHPKFAYAYTLQGHEHVENEEYDKALVAYRHAIAADKRHYNAYYG
IGKVHEKLGNYEKALSHYHSALLIHPTHAVLICCMGTILQRQKQIVQALPYFIRAVELAP
RAPEMRSKKAQALLVTGQLEEAKKELLILKDMAPNNAQVHFLLAKLAKTLGDKRTAVRHF
TIALSLDPKASGEIKNEIGGLEDEDCLDNSMMR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgacaagcgccgcgattgcgggcttgctgaagcagacggtctattatcacctc
gacaatctttcctaccagaacgcggtattctttgccgaaaggcttcatgcccacgatcag
cgttcgcacgagtccggcttcctccttgcgctttcccacttccgcctcggcgattcgcga
tcggcatacgaaatcagcaaaccgtcagctttccgaggcgcccacctagggtgttcgttc
gtcttcgcacagtcctgcttggacctggaacggtacaaggaaggcatcacggccctggaa
aaggcccggccgctatggactgccaaatgcagcgttgggaggcacacagcttccgcccgg
gcgccgtacccggatgcggccgccgtgagttgtctcctcggcaagctgtacagggcatac
gacgacaagaagagggcgattccctgtttcgaggatgcgctaagagctaaccccttcatg
tgggacgcatttaccattctctgcgatatgggcgtcaatgttatggtgcccaacatcttt
aagcttaacgacaattttgctcgcagcttcgaccaggaaccgggcgcgatcagtgtcgac
tccagtggaggccagccggaacctctacagcgaaaaaccggcttgcaggttgtcggccag
gacagcgacccattcgaagggcatcgatctaccgcttttcaagacgtttcgagcaacaat
atgctcttcgtcgacaccgaagagaatgacctgacattcaagctcattccagccccgaga
tatccttcgagcaaacacggccacgacggcgcggaaactccgactggccctaccgttgcc
cccgacgcgcaagcccctcgcttcggcctcccctcagagcccccattggcgccaactcgc
cgaacgcgggcagcccaggccgtcgagccgaatctctttgacgccgcgccgcccaaaatg
agctaccgcctgggctccaagaggcgggacaggggtcaggaccagatagccgatcctcca
gaagcggccgccagagggcccgcgcctgctttgtcgactacagaaagaaaacgcaccgca
tcagggcatcccgttcagccacgctcgaccaacggtgaggagccgaggaggagcgcgagg
ctcaatgttgccccccgaacgacctcgtcaagggctaactcgggcgtcgccgcgattggc
gccaacccccctcgcgagttgcggaaagctaggcccccgatctcgaggattgcacgaccg
ggctctagcggtaccggcgtcggtagggtcgtcagcggaaatcgcaagcctttggaagaa
aataatagtatggatattgaccaagctgaagcctcgcgggtcaaggagcaggccgctgtg
caagctccgccaccgaagccggccgagccggagctggtgaaggcagatgagggactcagg
tggatcctggatttcttgaagaagatcgcatcgggatatcggctctcgtcacagttccgg
tgccaagaagccctcactgccttcatggcgctgccccgaagtcatcaagacactccgtgg
gtcacggcgcggatcgcccgggcccactatgagctggccaactacgcagaagccgagaaa
tacttcaagcgcctccggatgctcgccccgacgcgccacgaagacatggaggtcttttcg
accgttctctggcagctgaggaaggagacggaactctcgtttctggcgcatgagctggtg
gacgctgtgtgggattcgccgcaggcctggtgtgcactggggaacgcgttctctctcgcc
tccgaccatgaacaagctctcaaatgcttcaggcgcgccatcctgctccacccgaaattc
gcatacgcctacactctgcaggggcacgagcacgtggagaacgaagaatacgacaaagct
ctggtggcataccggcacgcgatcgccgcagacaagcggcactacaacgcgtactacggg
attgggaaggtccacgaaaaactgggcaactacgagaaggcgctgagccactaccactcg
gcgttgttaatccacccgacgcacgcagttctgatctgctgcatgggcacgatcttgcag
aggcagaagcagattgtccaggctcttccttactttatcagggcggtcgagctggcgcct
cgggcgcccgagatgcgcagcaagaaagcccaggctttgctggtcacgggtcagctggag
gaagcgaagaaggagctgctgatcttaaaggacatggctccaaacaatgcccaggttcac
ttcttgcttgccaagctcgccaagacactcggagacaagaggacagcggtgcgccacttc
accatagccctgagcttggatccgaaggcgagtggggagatcaaaaacgagattggggga
ctcgaggacgaggactgtttggacaactccatgatgcgttga

DBGET integrated database retrieval system