KEGG   Thielavia terrestris: THITE_2119633Help
Entry
THITE_2119633     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ttt  Thielavia terrestris
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    THITE_2119633
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     THITE_2119633
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   THITE_2119633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(2896785..2897693,2897749..2898002,2898088..2898462,2898525..2898552)
Genome map
AA seq 521 aa AA seqDB search
MPALGFLRRRRTRDGNPGPSPPATPTASSSAEQPTVPRSSPHSSAGSQPAHRVSATATQQ
PGKPAEAEPMNTLPVQQPPYPVAQHTPSPGSQPQNVPRISNLINAPQQQQPQDSSAGYQQ
QHSGGQYAPYPSNHGAAAATTSNQAQPQPQQPQPQPQRQQDQQQAQQVQQAQQHYQPEQQ
QLAQQTVQAVQQVQQSEARVTRGRYSLADFEILRTLGTGSFGRVHLVQSRHNSRFYAIKV
LKKAQVVKMKQVEHTNDERRMLGEVKHPFLITLWGTFQDAKNLYMVMDFVEGGELFSLLR
RSGRFPNPVAKFYAAEVTLALEYLHARNIIYRDLKPENLLLDRHGHLKITDFGFAKRVPD
KTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFYDSGSAMKIYENILR
GKVKYPAYVNPDAQDLLERLITADLTKRLGNLYGGSQDVKNHPWFAEVTWDRLARKDIDA
PYSPPVRAGAGDASQFDRYPEETEQYGQTGHDEYGYLFPDF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcggcttcctgagaaggagacggacgagggacggcaacccgggcccctcg
ccgcccgcaaccccgaccgcgagcagcagcgccgagcagcccaccgtcccgcgcagctct
ccccattccagcgccggttcgcaacccgcccaccgcgtgtccgcaactgctactcaacag
ccaggcaagccggccgaagcggaaccaatgaacacgctacccgtgcagcagccaccttac
ccagtggcgcaacacacgccctcccctgggtcccagccgcagaacgtgccgcgcatctcg
aacctgatcaatgccccgcaacagcaacagccgcaggacagttcggccgggtaccaacag
cagcattcgggcggtcaatatgctccgtatccctctaaccacggggcggcggcggcgacg
acatcaaatcaggcccagccccagccacagcagccgcagccgcagccgcagaggcagcag
gatcagcaacaggcacagcaagtacaacaagcgcagcagcactatcaaccagaacagcaa
caactagcacagcagacggtgcaggcggtgcagcaggtgcagcagagcgaggctcgggtg
acgaggggaagatactcgctggcggactttgagattttgcggacgctcgggacgggcagc
ttcggcagggtccatctggtgcagtcaagacacaacagccggttctacgccatcaaggtc
ctgaagaaggcgcaggtggtcaagatgaagcaggtggagcacaccaatgacgagaggagg
atgctgggcgaggtgaagcacccgttcctgatcacgctgtggggcaccttccaggacgcg
aagaacctctacatggtgatggactttgtcgaaggcggcgagctcttctcgctgctcagg
agatcaggccgcttccccaatccggtggccaagttctacgccgccgaggttacgttggcc
ctagagtatctgcacgcgcggaacatcatctaccgagacctgaagccggaaaacctgctg
cttgaccggcacggccacctcaagatcacggatttcgggttcgccaagcgcgtgccggac
aagacctggacgctctgcggcaccccagactacctggcacccgaagtcgtctccaacaaa
ggctacaacaaatcggtagactggtggtcattaggcatcctgatctacgagatgctctgc
gggtacacgccgttctacgacagcggctcggccatgaagatctacgagaacatcctccgc
ggcaaggtcaagtacccggcctacgtcaacccggacgcgcaggacctgctcgagcggctc
atcacggccgacctcaccaagcggctgggcaacctgtacggcgggtcccaggacgtcaag
aaccacccctggtttgccgaggtgacgtgggaccggctggcgcgcaaggacatcgacgcg
ccgtactcgccgccggtccgggccggcgccggcgacgccagccagtttgaccggtacccc
gaagagacggagcagtacggacaaaccgggcatgacgaatacggctacctgtttccagac
ttttga

DBGET integrated database retrieval system