KEGG   Thielavia terrestris: THITE_2119799Help
Entry
THITE_2119799     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ttt  Thielavia terrestris
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    THITE_2119799
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    THITE_2119799
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     THITE_2119799
Protein phosphatases and associated proteins [BR:ttt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     THITE_2119799
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     THITE_2119799
Spliceosome [BR:ttt03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    THITE_2119799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3149978..3150070,3150136..3150435,3150510..3150911,3151031..3151210))
Genome map
AA seq 324 aa AA seqDB search
MADQHEVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVHGLGGGSRPTTPRKSSKS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccaacacgaagtcgatctcgactccataatcgatcgcctcttggaggtgcgg
ggcagccgcccgggcaagcaagtccagctactcgaggctgagattcgctatctctgcacc
aaggcccgcgagattttcatctcccagcccattttgctcgagctcgaagctcctattaag
atttgcggtgacatccatgggcaatattacgacttgctccgcctcttcgaatacggcggc
ttcccgcctgaggccaactatctcttcctcggcgactacgtagaccgcggcaagcagtcg
ctcgagaccatctgtctgctcctcgcgtacaagatcaagtacccggagaacttcttcatc
ctgcgcggcaaccacgagtgtgcgtccatcaaccgcatctacggcttctacgacgagtgc
aagcgtcgctacaacatcaagctgtggaagacgttcaccgactgcttcaactgcttgccc
attgccgccatcattgacgagaagatcttcaccatgcacggcggtctcagccccgacttg
aactcgatggagcagatccgccgtgtcatgcggccgacagatattccggactgcggcctc
ctgtgcgacctcctctggtcggatccagacaaggacattaccggctggtccgagaacgac
cgcggtgtttcgttcaccttcggtccagatgtcgtctcccggttcctgcaaaaacacgac
atggacctgatctgccgagcccaccaggtcgtggaggacggctacgagttcttctcgaag
cgtcagctcgtcaccctgttcagcgcgcccaactattgcggcgagttcgacaacgccggt
gccatgatgagcgtggatgaaagcttgctctgctccttccagatcctcaagccggcggag
aagaaacaaaagtatgtccacggcctcgggggcggtagccgacccaccactcccaggaag
tcgtccaagtcctaa

DBGET integrated database retrieval system