KEGG   Thielavia terrestris: THITE_2119863Help
Entry
THITE_2119863     CDS       T02228                                 

Definition
histone acetyl transferase HAT1-like protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3238309..3239759,3239815..3239833))
Genome map
AA seq 489 aa AA seqDB search
MPSDDTWSTPSNDALVLSLVSPTPTGLKTVGHSFHPRFTYPIFGDSEEIFGYQKLEINLQ
YHASDMRPNLSVTYGKKFPAVGDTEATDVEAILREFLPEVAFQSKQDFETAVKNLPQDWS
PPGELTATFSAHDQTFEVWKGSLADPAVKQLVKRIQILVPLFIEGGTQLNVDDSDANRWT
VFFLYRKTATAGDAGPSPYVFAGYCTVYRFFHLRLPTPPLSPSEADLEKQLLSQDFDLDQ
LACRSRISQFIIIPPFQGKGLGPRLYSIIFNEYIKHPQTVEITVEDPNEAFDDLRDVADL
QYLRRLPEFQELRINTDIVIPKAGMAPNNIVDKAASEAVRAKAKMVPRQFARVLEMNLLS
RLPEHVRASAAKEEGGPQPTKEEQHEYRLWRLLLKKRIYQQNKDALGELEIPERIAKLED
TVTSVEFDYARLLIKAEDQQENGSAQRQESGAEKQEAARAAANGTANGKRKAAEDGEQSA
SKKARVEDE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagacgacacttggtcgacgccgtcaaacgacgcgctcgtgttgtcgctggta
tcccccaccccgaccggtctcaagactgtcggccacagtttccaccccagattcacgtac
cccatctttggcgacagcgaggagatcttcggctaccaaaagctcgaaatcaaccttcag
taccatgcgagcgacatgcgaccaaatctctccgtcacctacggcaagaagtttcccgcc
gtaggcgacacagaggcaaccgacgtcgaagccatcctgcgcgagttccttccagaggtc
gcgttccagagcaaacaggacttcgagacggcggtcaagaatctcccgcaagactggagc
cccccgggcgagttgaccgcgacgttcagcgcgcatgaccagaccttcgaagtttggaaa
gggagtctggccgacccagcggtcaagcagctggtcaagcgcatccagatacttgtcccg
cttttcatcgagggcggcacacagctcaacgtggatgattccgacgccaaccgctggact
gtcttttttctgtaccggaaaacagcgaccgccggggatgccggcccctcgccgtacgtc
ttcgccgggtactgcacggtctaccgcttcttccacttgcgactgccaacgccgcctctc
tcgccttccgaggccgacctggagaagcagctgctcagccaagatttcgatcttgaccaa
ctcgcctgccgcagcagaatctcccagttcatcatcatcccaccctttcaaggaaagggc
ctcgggcccaggctttacagcatcatcttcaacgagtacatcaagcacccgcagacggtc
gagataaccgtcgaggacccgaacgaagcgttcgacgacctgcgcgacgtcgcagacctg
cagtatctgcgacggcttcccgagtttcaagagctgcgcatcaacacggacatcgtgatt
cccaaggcgggcatggcgcccaacaacattgtcgacaaggcggcgtccgaggcggtgcgc
gccaaagctaagatggtcccccgccaattcgcgcgggtcctcgagatgaacctcctttcg
cggcttcccgagcacgtccgggctagcgcggcaaaggaggagggaggcccgcaaccgacc
aaggaagaacagcatgagtaccggctctggaggctgctgctgaagaagaggatataccag
cagaataaggatgccctgggcgagctcgagatcccagaacgcattgccaaactcgaggac
acggtcaccagtgtcgagttcgactatgcccgacttctgatcaaggctgaagatcagcag
gagaacgggtctgcgcagcggcaagagagtggggcggagaagcaagaagcggccagggct
gccgcgaatggcacggccaacgggaagcgcaaggcggctgaggatggcgagcaatcggcc
agcaagaaggcgagagtcgaggacgaataa

DBGET integrated database retrieval system