KEGG   Thielavia terrestris: THITE_2119959Help
Entry
THITE_2119959     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ttt  Thielavia terrestris
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ttt04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3360511..3360667,3360739..3361400,3361469..3362086))
Genome map
AA seq 478 aa AA seqDB search
MAGGARSGGRAPRLGLAIPPSPNVQPVGNQGAAPPRPALPTLHLATPMGSTTVPQEQPHK
PLSLQSASGGSESSAAHSRSGSFGPLDGRASNPTSAGSQFSALSFASQYGIGSTRQTGDP
VSAVGSLYSNASESVDGEGSLHGLESFDKLTLEKARSADVEDLDDEGWRIVSMEKRIIEL
GTLGEGAGGAVTKCKLQGGNTLFALKVITTNPDPDAKRQIIRELGFNKGCASQHICRYYG
AFVDPATATISIAMEFCEGGSLDSIYKEVKRLGGRTGEKVLGKIAEGVLQGLTYLHSKKI
IHRDIKPSNILLCRNGDVKLCDFGVSGEFGTKGDASTFIGTSYYMAPERITGQSYTITSD
VWSTGITLLEVAQHRFPFPVDGTEMQPRASPLDLLTYIVKHPTPKLKDEPEANIYWSGNF
KYFIDCCLEKEPARRATPWRMLEHPWMKEMATKRVNMRRYLSQVWGWDEQETQAQSQA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggcgctcgttctggcggccgtgccccccgcctggggctcgccattcctccg
tctcccaatgtccagcccgtcggaaaccaaggggctgctcccccgcgtccagcactgccc
acgctccacctcgcgacgccgatgggcagcaccacggtgccgcaggaacagccacacaag
cccctgagcctgcagagtgctagcggcggcagcgaaagcagcgctgcccatagcagaagc
gggagctttgggccactagacggccgcgccagcaaccccaccagcgccggctcccagttc
agcgccctctccttcgccagccaatacggtatagggtccacaagacagaccggggatccg
gtgtcggctgtcggatcgctctattcgaacgcgagcgagagcgtggacggggagggcagc
ttgcacgggctagaaagcttcgacaagctgactctggagaaggcgaggtcagccgatgtg
gaagatctggacgacgagggctggcggatcgtgagtatggagaagcggatcatcgagctc
ggaacgctgggtgaaggagccggcggtgctgtgacaaaatgcaagttgcagggcggcaac
accttgtttgcgctcaaggtcatcacaacaaaccctgatcccgatgcgaagcggcagatc
attcgcgagctgggcttcaacaagggatgtgcttcacaacacatttgccgctactacggc
gcattcgtcgacccagccacagccaccatttccatcgccatggagttctgtgagggcggg
tcgctcgacagcatctacaaggaggtcaagcgcctcggcggacggacgggcgaaaaggtt
ttgggcaagattgccgaaggcgtcttgcagggcttgacctatctgcactccaagaagatc
attcaccgcgacatcaagccgagcaacattctgctctgccgtaacggcgatgtcaaactc
tgcgactttggcgtgtctggcgagttcggcaccaagggtgacgctagcaccttcatcggc
accagctattacatggcaccagagcgcatcaccggccagtcgtacaccatcacgtccgac
gtgtggtctaccggcatcacgctgctcgaggtcgcccagcaccgcttccccttcccggtc
gacggcaccgagatgcagccacgcgctagcccgctagatttgctgacgtacatcgtcaag
caccccacgcccaagctcaaggacgagcccgaagccaacatctactggagcggcaacttc
aaatacttcatcgactgctgtcttgaaaaggagcccgctcgccgagccaccccctggcgc
atgctggaacatccctggatgaaggagatggccaccaagcgcgtcaacatgcgccgttac
ctctcgcaggtctggggctgggacgagcaggaaacccaggcacaatcgcaggcatag

DBGET integrated database retrieval system