KEGG   Thielavia terrestris: THITE_2119959Help
Entry
THITE_2119959     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ttt  Thielavia terrestris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    THITE_2119959
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     THITE_2119959
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   THITE_2119959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(3360511..3360667,3360739..3361400,3361469..3362086))
Genome map
AA seq 478 aa AA seqDB search
MAGGARSGGRAPRLGLAIPPSPNVQPVGNQGAAPPRPALPTLHLATPMGSTTVPQEQPHK
PLSLQSASGGSESSAAHSRSGSFGPLDGRASNPTSAGSQFSALSFASQYGIGSTRQTGDP
VSAVGSLYSNASESVDGEGSLHGLESFDKLTLEKARSADVEDLDDEGWRIVSMEKRIIEL
GTLGEGAGGAVTKCKLQGGNTLFALKVITTNPDPDAKRQIIRELGFNKGCASQHICRYYG
AFVDPATATISIAMEFCEGGSLDSIYKEVKRLGGRTGEKVLGKIAEGVLQGLTYLHSKKI
IHRDIKPSNILLCRNGDVKLCDFGVSGEFGTKGDASTFIGTSYYMAPERITGQSYTITSD
VWSTGITLLEVAQHRFPFPVDGTEMQPRASPLDLLTYIVKHPTPKLKDEPEANIYWSGNF
KYFIDCCLEKEPARRATPWRMLEHPWMKEMATKRVNMRRYLSQVWGWDEQETQAQSQA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggcgctcgttctggcggccgtgccccccgcctggggctcgccattcctccg
tctcccaatgtccagcccgtcggaaaccaaggggctgctcccccgcgtccagcactgccc
acgctccacctcgcgacgccgatgggcagcaccacggtgccgcaggaacagccacacaag
cccctgagcctgcagagtgctagcggcggcagcgaaagcagcgctgcccatagcagaagc
gggagctttgggccactagacggccgcgccagcaaccccaccagcgccggctcccagttc
agcgccctctccttcgccagccaatacggtatagggtccacaagacagaccggggatccg
gtgtcggctgtcggatcgctctattcgaacgcgagcgagagcgtggacggggagggcagc
ttgcacgggctagaaagcttcgacaagctgactctggagaaggcgaggtcagccgatgtg
gaagatctggacgacgagggctggcggatcgtgagtatggagaagcggatcatcgagctc
ggaacgctgggtgaaggagccggcggtgctgtgacaaaatgcaagttgcagggcggcaac
accttgtttgcgctcaaggtcatcacaacaaaccctgatcccgatgcgaagcggcagatc
attcgcgagctgggcttcaacaagggatgtgcttcacaacacatttgccgctactacggc
gcattcgtcgacccagccacagccaccatttccatcgccatggagttctgtgagggcggg
tcgctcgacagcatctacaaggaggtcaagcgcctcggcggacggacgggcgaaaaggtt
ttgggcaagattgccgaaggcgtcttgcagggcttgacctatctgcactccaagaagatc
attcaccgcgacatcaagccgagcaacattctgctctgccgtaacggcgatgtcaaactc
tgcgactttggcgtgtctggcgagttcggcaccaagggtgacgctagcaccttcatcggc
accagctattacatggcaccagagcgcatcaccggccagtcgtacaccatcacgtccgac
gtgtggtctaccggcatcacgctgctcgaggtcgcccagcaccgcttccccttcccggtc
gacggcaccgagatgcagccacgcgctagcccgctagatttgctgacgtacatcgtcaag
caccccacgcccaagctcaaggacgagcccgaagccaacatctactggagcggcaacttc
aaatacttcatcgactgctgtcttgaaaaggagcccgctcgccgagccaccccctggcgc
atgctggaacatccctggatgaaggagatggccaccaagcgcgtcaacatgcgccgttac
ctctcgcaggtctggggctgggacgagcaggaaacccaggcacaatcgcaggcatag

DBGET integrated database retrieval system