KEGG   Thielavia terrestris: THITE_2121057Help
Entry
THITE_2121057     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THITE_2121057
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2121057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:1204472..1206550
Genome map
AA seq 692 aa AA seqDB search
MRPEDKPDSPEYKKKQAMIRGPVLDLAQENTDPYGMEECTFTGLKDIFTALIESQSRTGV
LSPRRFLDIFKRNNEMFRNSMHQDAHEFYGIVLNDVIANVEANGRRMQEVAASRKQGDPS
QASGPALSTNEAALTTKSPGTGWVHDIFEGVLTSETRCLTCETASQRDETFLDLSIDLEE
HSSVTACLQQFSAEEMLCERNKFHCDHCGGLQEAEKRMKVKKLPKVLALHLKRFKYTEDY
SRLQKLFHRVVYPYHLRLFNTTDDAEDPDRMYELYAVVVHIGGNAYHGHYVAVIKTKDRG
WLLFDDEMVEPVDKSFVQNFFGDKPGMACAYVLFYQETTFEKVREELDAEGLDQVKLANQ
TADLAATADHVNGASPSALSKLNSQPLPPVEEHVTLAALEQTKSAPTEIDVVSPMDQLPP
PLSQSGAHPLVAAPPPPPAVMTKSDEAAAVPPKSKEEMAREKKELKAREKAEEKARKAAE
KEQARIAMKERQEQLQRIRELARLEREQLQKAIQESKQTAAEEGKRQKKEAAAAAAAADA
SSSSEGGANGFLNRAGRTRKSMTRKSFAFLHLGLNSKDEQKGDSQADRADRSEASDDRSD
RGDRGETSAAGEGGHPSQQNGVSGGKQGSHSSLTARPLPRSEPAPGAVDQLRNDKDKDKD
KEKDKEKEKPPLKERLSFGLGRKKSSRFFSPP
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgaggacaagcctgactcgccagagtacaagaagaagcaggccatgataagg
ggcccggtactagacctggctcaggagaacacagacccatatggcatggaagagtgtacc
ttcacgggcctcaaagacatctttacagccctgatcgagagccagtccaggaccggtgtg
ctaagcccccggaggttcctggacatattcaagcgcaacaacgagatgttccgcaactcg
atgcaccaggacgcccacgagttctacggcattgtactcaacgacgtgatcgccaacgtg
gaggccaacggcaggcggatgcaagaggtggcagcgagcagaaagcagggcgatccctca
caggcttccgggccagcgctgtcgacgaacgaagcagctcttacgacgaagtcgccgggg
accggctgggtgcacgacattttcgagggggtgctgacctcggagaccaggtgcttgacc
tgtgagacggcatctcagcgggacgagacgtttctggatttatccattgacctggaggag
cactcatccgtcacggcgtgtctgcagcagttctctgccgaggagatgctgtgcgagagg
aacaagttccactgcgaccactgcggcggcttgcaggaagccgagaagcggatgaaggtc
aagaagctccccaaggtcctggcgctacacctgaaacggttcaaatacaccgaggactat
agccgcctgcagaaactcttccaccgagtagtctatccttaccacctccgcctgttcaac
accaccgacgatgccgaggatcccgacaggatgtacgagctttatgccgtggttgtgcac
atcggaggcaacgcgtaccacgggcactacgtcgctgtcatcaagacaaaagatcgtggc
tggctgctctttgacgacgagatggtggagccagtggacaagagcttcgtgcagaacttc
ttcggggacaagcccggaatggcttgtgcttacgtgctgttctaccaggagacgaccttt
gaaaaggtgcgggaagagctcgatgccgagggcctggaccaggtgaagctggccaaccaa
acagcggatcttgcagcgaccgccgatcatgtcaacggagcaagtccgtctgccctctcc
aagctcaactcacaacctttgccccccgttgaggagcatgtcacactagccgccctggaa
caaacaaagtcggcgccgaccgagatcgacgttgtcagccccatggaccaactgccccca
ccgctctcccaatccggtgcccacccgctggttgcggcgccgccacctcctcccgcagtt
atgacgaagtcagacgaagccgccgccgtcccaccgaagtcaaaggaagaaatggccaga
gaaaagaaggagctcaaagcccgagagaaggccgaagagaaggcccggaaagcggcggaa
aaggagcaagctcgaattgcgatgaaggagcgtcaggagcagctgcagaggatacgcgaa
cttgcgcgtctagagcgtgagcaactgcagaaggccatccaggagagcaagcagacggcg
gcggaagaaggaaagcggcagaagaaagaggcggcggcggcggcagcagcagcagatgca
agttcctcctccgaaggtggagcgaacgggtttctcaaccgtgcgggtcggacgcgcaag
tcgatgacgcgcaagagcttcgccttcttgcacctcgggctgaacagcaaggacgagcaa
aaaggcgattcccaggctgacagagcggaccgcagcgaggcgagcgacgacaggagcgac
aggggcgacaggggcgaaaccagcgccgctggcgaaggcggccacccgtcacagcagaac
ggcgtcagtggtggtaaacaaggcagccactcatccctcaccgcgcggccgctgccgcgg
tccgaaccggcacctggtgcggtcgatcagctgcgcaatgacaaggacaaggataaggac
aaggagaaggacaaagagaaggagaagccgccgctaaaggagaggctcagttttgggttg
ggaaggaaaaagagcagcaggttcttctctccgccttag

DBGET integrated database retrieval system