KEGG   Thielavia terrestris: THITE_2121574Help
Entry
THITE_2121574     CDS       T02228                                 

Definition
glycoside hydrolase family 20 protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ttt  Thielavia terrestris
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    THITE_2121574
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    THITE_2121574
   00603 Glycosphingolipid biosynthesis - globo series
    THITE_2121574
   00604 Glycosphingolipid biosynthesis - ganglio series
    THITE_2121574
   00511 Other glycan degradation
    THITE_2121574
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     THITE_2121574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(1890803..1891228,1891346..1892512,1892609..1892758))
Genome map
AA seq 580 aa AA seqDB search
MLSSAFSSLSLFLLALSPVAAVWPAPQKYSNGSSVLYLHQNIKVTYNGEFLPYTAGYAPQ
KLSSKEVVQAGVSRTLSAIFGSKFVPWKLHKPGSQFEPDLRKGQKWLNTLQIVQTGKDQA
STFKPLAGEVDESYNLTVSDSGDVKLTAVSSIGVLRGLETFSQLFYQHSAGPFWYTPYAP
VSIQDAPKFPHRGVMIDTARNFFPVPDILRTIDAMAWNKLNRLHVHVTDSQSWPLVIPSM
PELAAKGAYHPSQTYSPEDVATIQQYGAERGVEVYFEIDMPGHIGVVSLSHPDLIVAYDQ
LPYYWWCNEPPCGAFKLNSTAVDAFVEKLFDDLLPRLAPYAAYFHTGGDELNKNDSMLDD
GVRSNSSEVLQPLLQKFIDAQHARVRKAGLTPMTWEEIPLDWNITLGKDTVVQSWLGGDS
VKKLTGMGLQVIDSDYNFLYLDCGRGQWINFGNGAAFDVGYPFNDWCGPTKSWRLIYSHD
PTANLTPEEAKLVLGGEVAVWSETIDPVNFDSLVWPRASAAGEVLWSGRTDASGQNRSQL
EAAPRLNEFRERMVLRGVGASPVQMTFCTQGSPEECNWPA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcatcggcattttcgagtctctcgctctttctcctcgccctcagtcctgtcgcg
gcagtctggcccgcgccgcagaagtacagcaacggcagctcggtcctgtacctgcaccaa
aacatcaaagtcacctacaatggcgaatttcttccgtacaccgcgggatatgcgccgcag
aagttgagcagcaaggaggtggtccaggcgggagtgtctcgcacgctctccgccatcttc
ggcagcaaattcgtgccctggaagctgcacaagcccgggtcccagttcgagcccgacctg
cggaagggccagaaatggctgaacacgctgcagatcgtgcagacgggaaaggaccaggcc
agcaccttcaagccgctggccggcgaggttgacgagtcgtacaacctgaccgtgagcgac
agcggcgacgtcaagctgacggccgtctcgtcgatcggcgtcctccgcgggctcgagacc
ttcagccagctcttctaccagcactcggccggccccttctggtacacgccgtacgcgccc
gtgtcgatccaggacgcgcccaagttcccgcaccgcggcgtcatgatcgacacggcccgc
aacttcttccccgtgcccgacatcctgcgcaccatcgacgccatggcctggaacaagctc
aaccggctgcacgtgcacgtgaccgactcgcagtcgtggccgctcgtgatcccctcgatg
cccgagctggcggccaagggcgcctaccacccgagccagacctactcgcccgaagacgtg
gccacgatccaacagtacggcgccgagcgcggcgtcgaggtctacttcgagatcgacatg
ccgggtcacatcggcgtcgtgtcgctctctcacccggacctcatcgtggcctacgaccag
ctgccgtactactggtggtgcaacgagccgccgtgcggcgccttcaagctcaacagcacc
gccgtggacgccttcgtcgagaagctgttcgacgacctgctgccgcgcctggcgccgtac
gcggcctacttccacacgggcggcgacgagctcaacaagaacgactcgatgctcgacgac
ggcgtccggtccaactcgtccgaggtgctgcagccgctgctgcagaagttcatcgacgcg
cagcacgcgcgcgtgcgcaaggccggcctgacgcccatgacgtgggaggagatcccgctc
gactggaacatcacgctcggcaaggacacggtcgtgcagtcgtggctcggcggcgactcg
gtcaagaagctgaccggcatgggccttcaggtgatcgacagcgactacaatttcttgtac
ctcgactgcgggcgcgggcagtggatcaacttcggcaacggcgcggccttcgacgtcggc
tacccgttcaacgactggtgcggcccgaccaagagctggcggctgatctactcgcacgac
ccgacggcgaacctgacgccggaagaggcgaagctggtgctgggcggcgaggtggccgtc
tggagcgagaccatcgacccggtcaacttcgactcgctcgtgtggccgcgcgccagcgcc
gccggcgaggtgctctggtccggccgcaccgacgcatccggccagaaccgcagccagctc
gaggccgccccgcgcctgaacgagttccgcgagaggatggtgctgcgcggcgtcggcgcg
tcgcccgtgcagatgaccttctgcacgcagggctcgcccgaggagtgcaattggccggcg
tga

DBGET integrated database retrieval system