KEGG   Thielavia terrestris: THITE_2121578Help
Entry
THITE_2121578     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ttt  Thielavia terrestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THITE_2121578
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     THITE_2121578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(1897291..1897731,1897850..1898515,1898606..1899532)
Genome map
AA seq 677 aa AA seqDB search
MYATRPRCLAHAAGRAGAKRRFPRGSFSFGRSSPDADAGNASASAATRRRYATAANKGQP
PRSIAVLGGGLTGLTTAWHLTRALPHARITLYEASDRLGGWIDTSTVNLRNRYGQEGPVH
FERAARMVRPQTGGRVPRWDDLLFFDMVAHLNLTDQLMHASAEDSGTTAYIYYPNRLVPI
PRISRAGPLRTLDSILDLVPALFQPVFRDVIPSALHNARTTGDPYTADILEGRSDVSVGD
YFAYRFGRTGLVDKVFSAVTHGMTGGDVWKQSLASGSWADYLPRNDGEPVTRVRVRRADY
ALMNQLVRDKAVFDLATEHLDSGSLWFRNGMSTLTNALADALRKNPNVTIKMGDPVTSVR
YLDNFDRVFITTKQNKKPVPYEKVVSTIYAKHLAALTDDHLPSLASSTAVSIMIVHLWYP
DLRVHSPNTGFGYLLPQAVPHEANPECVLGVIFDSDREFPTTKLFSLTNLGADGVEGTKM
TVLMGGHYWDGLPESFIPDPAAAADMARAAVQRHLRLSDRVARSAYAAAQLCRDCIPQLL
VGHAARMRAAHAELQWTFRGRLAVAGQSYQPSGVLTMLRAGRDIAMQIAHSSSSSSSSGT
AQRPPPLRGEEEEGEEEAAYADAAAADGYDDDWPVGDTGLERFTRQPTWLSVEKRLLPLR
FKSGAYVDEDGNIQPGD
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccacacgtccgcgctgcctagcgcacgccgcgggccgcgccggggccaagcgc
cgctttccgcgaggctccttctccttcggccggagctcacctgacgccgacgccggcaac
gccagcgcctccgctgcgacccggcgacgctatgccaccgccgccaacaagggccagccg
ccgcgctccatcgccgtgctcggcggcgggctgaccggcctcaccacggcctggcacctg
acccgcgccctgccccacgcccgcatcacgctctacgaggcgagcgaccggctcggcggc
tggatcgacacgtcgacggtcaacctgaggaaccgctacggccaggagggtcccgtgcac
ttcgagcgcgccgcccgcatggtcaggccgcagaccggcggccgtgttccccgctgggac
gacctgctgttcttcgacatggtcgcccatctgaacctcaccgatcagctcatgcacgcc
agcgcggaggactccgggaccaccgcctacatctactaccccaaccgtcttgtgcccatt
cccaggatctctcgggccggtccgctccgcactctcgactcgatcctcgaccttgtccca
gcgctcttccagcccgtgttccgggatgttattccttctgcgcttcacaatgcgcgcaca
acaggcgacccgtataccgccgacatcctggagggacgcagcgacgtgtccgtgggcgac
tacttcgcctatcgctttgggcgaaccggcctggtggacaaggtcttctcggccgtgacc
cacggaatgacgggcggcgatgtgtggaaacagagcttggccagcgggagctgggcagac
tacctgccgcgcaacgacggcgagccggtgactcgcgtacgcgtccgccgcgccgactac
gcgctgatgaaccagctggtccgcgacaaggccgtctttgacctggccaccgagcacctc
gactcgggctcgctctggttccgcaacggcatgagcaccctgaccaacgcgctcgccgat
gccctcagaaagaaccccaacgtcaccatcaagatgggcgacccggttacctcggtccgc
tatctcgacaatttcgacagggtctttatcaccacgaaacagaacaaaaagcccgtccct
tacgaaaaagttgtctccaccatctacgccaaacacctcgctgccctcaccgacgaccac
ctcccctccctcgcctcttccaccgccgtatccatcatgatcgtccacctctggtacccc
gaccttcgtgtccattcccccaacaccggcttcggctacctcctcccacaagcggtgccg
cacgaagccaacccggagtgcgtgctcggcgtgatcttcgactcggaccgggagttcccg
acgaccaagctcttcagcttaaccaacctcggcgccgacggcgtggagggcaccaagatg
accgtcctgatgggcggccactactgggacgggctgccggagtcgttcatcccggacccg
gccgcggcggcggacatggcgcgcgccgccgtgcagcgccacctgcgcctgtccgaccgc
gtcgcgcgcagcgcctacgccgccgcccagctctgccgcgactgcatcccccagctgctc
gtcggccacgccgcccgcatgcgcgccgcccacgccgagctccagtggaccttccgcggc
cgcctcgccgtcgccggccagtcctaccagccctccggcgtgctgaccatgctgcgcgcc
ggcagggacattgccatgcagattgctcactcctcctcctcctcctcctcctccgggacg
gcgcagcggccgccgccgcttcggggtgaagaagaagaaggagaagaagaggctgcctat
gctgatgccgccgccgccgacggctacgacgacgactggccggtgggcgacaccggcctg
gaacgcttcacccgccagccgacctggctgtcggtcgagaagaggctgctgccgctgcgg
ttcaagagcggcgcgtacgtcgacgaggacggcaacatccagcctggggattag

DBGET integrated database retrieval system