KEGG   Thielavia terrestris: THITE_2121787Help
Entry
THITE_2121787     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ttt  Thielavia terrestris
Pathway
ttt00040  Pentose and glucuronate interconversions
ttt00052  Galactose metabolism
ttt00500  Starch and sucrose metabolism
ttt00520  Amino sugar and nucleotide sugar metabolism
ttt01100  Metabolic pathways
ttt01130  Biosynthesis of antibiotics
Module
ttt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THITE_2121787
   00052 Galactose metabolism
    THITE_2121787
   00500 Starch and sucrose metabolism
    THITE_2121787
   00520 Amino sugar and nucleotide sugar metabolism
    THITE_2121787
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     THITE_2121787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 11522542
NCBI-ProteinID: XP_003656728
JGI: Thite2_2121787
UniProt: G2RFA9
Position
5:complement(join(2169012..2170302,2170360..2170436,2170497..2170592,2171141..2171257))
Genome map
AA seq 526 aa AA seqDB search
MAAQAFKSALPSHLKPNNNNNGDEAEFAKRHHGKTRSHMAFENTSTNIAAAQMRNALTNL
AETVKDPEQKKLFETEMDNFFSLFRRYLNDKAKGNEVSWDRIAPPAEGQVVDYEDLPNSE
SASFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSVRQVEYLNRTYGSNVPIV
LMNSFNTDEDTAAIIKKYEGHNVDILTFNQSRYPRIYKDSLLPVPKSFDSPLHDWYPPGH
GDVFESLYNSGILDKLLARGIEIIFLSNADNLGAVVDLRILQHMVESEAEYIMELTNKTK
ADVKGGTIIDYEGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLKAIKRVVENDE
LEMEIIPNGKTIPGDKKGESDISILQLETAVGAAIKHFRNAHGVNVPRRRFLPVKTCSDL
MLVKSDLYTVKHGQLQMSANRFGDAPLIKLGSDFKKVSDFQKRIPSIPKIIELDHLTITG
AVNLGRGVTLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacaagcgttcaagagtgcgctcccgtcgcacctgaagcccaacaacaacaac
aatggcgacgaggccgagttcgccaagaggcaccatggcaagacaagatcccacatggcg
ttcgagaacacgtccaccaacatcgcggccgcccagatgcgcaatgcgctcacgaacctc
gccgagacagtgaaggaccccgagcagaagaagctgttcgagacggagatggacaacttc
ttctcgctcttccgccggtatctgaacgacaaggcgaagggaaacgaagtttcgtgggac
cgcattgcgccccctgctgagggccaagtcgtcgactacgaggatctgccgaactccgag
tcggccagcttcctcaacaagctggccgtgctgaagctgaacggcggtctgggcacgtcg
atgggttgcgtcggccccaagtcggtcatcgaggtccgcgatggcatgtcgttcctcgac
atgtcggtccgccaggtcgagtatctcaaccgcacatacggatccaacgtgcccatcgtg
ctcatgaactcgttcaacaccgacgaggataccgcggccatcatcaagaagtacgagggt
cataacgtggacatcctcaccttcaaccagtcccggtatcccaggatctacaaggactcg
cttctccccgtgcccaagtcgttcgactcgcccctccacgactggtacccgccaggacac
ggtgacgtgttcgagtccctgtacaactcgggcatcctcgacaagctcctcgctcggggc
atcgagatcatcttcctctccaatgccgataatctcggtgccgtcgtggacctgcgcatc
ctgcagcacatggtggagagcgaggccgagtacatcatggagctgaccaacaagacaaag
gccgacgtcaagggcggcaccatcatcgactacgagggcagcgtgcgcctgctcgagatt
gcgcaggtgcccaaggagcacgtcaacgagttcaagtcgatcaagaagttcaagtacttc
aacacgaacaacatctggatgaacctgaaggccatcaagcgcgtcgtggagaacgacgag
ctcgagatggagatcatccccaacggcaagaccatccccggcgacaagaagggcgagtcg
gacatcagcatcctgcagctcgagacggccgtcggcgccgccatcaagcacttcagaaac
gcgcacggcgtcaatgtcccgcgccgccgcttcctacccgtcaagacgtgctcggacctg
atgctcgtcaagtcggatctgtacactgttaagcacggccagctgcagatgagcgccaac
cgcttcggcgatgcgcccctgatcaagctcggcagcgacttcaagaaggtctcggacttc
cagaagcgcatccccagcatccccaagatcatcgagctcgaccacctgaccatcacgggc
gccgtcaacctcggccgcggcgtcactctcaagggcaccgtcatcatcgtcgccaccgag
ggccagaccatcgacatcccgccgggatccatcctcgagaacgtggtggtccagggcagc
ttgcgcttgcttgagcattag

DBGET integrated database retrieval system