KEGG   Thielavia terrestris: THITE_2122302Help
Entry
THITE_2122302     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     THITE_2122302
    1.3.1.94  polyprenol reductase
     THITE_2122302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3080955..3081480,3081560..3081960)
Genome map
AA seq 308 aa AA seqDB search
MDPSSFSPAQWCQAFFFAVGLFIVSIHLAGPLSLKINWLGYGPRTLGAGGGGARKQPATA
VAIAVPSRVSVPHSWFISFYYTSVLLSAFWAHQLSTRGAIAMRLVRWQAAAGGPSMTVTQ
VALLWAMMLFQGLRRLLECVLVMKLSAKSTMWVMYWVAAEGFYLCMSISVWIEGSGAILE
TPDPVAALDPLSIANARTAIALVFFLSGALLQNQSHRHLASLEKYSLPSAGMFKYIICPH
YTAECLVYLGLALAAAPEGRVLNTTLLAALLFTFTNLAISAKTTRDWYSEKFGADKVAKK
WNILPFVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggacccctcctccttctcgccggcacaatggtgccaggccttcttcttcgccgtcggc
ctgttcatagtcagcatccacctggccgggcccctgtcgctcaagatcaactggctcggc
tacggcccgcgcaccctgggcgccggcggcggcggcgcccgcaagcagccggccaccgcc
gtcgccatcgccgtcccatcgcgcgtttccgtgccccactcctggttcatctccttctac
tacacgtctgtcttgctctccgccttctgggcgcaccagctctcgacgcggggcgccatc
gccatgcgcctcgtccgctggcaggccgcggccggcgggccgtccatgacggtcacccag
gtcgcgctgctgtgggccatgatgctgttccagggcctgaggaggctgcttgagtgcgtg
ctggtgatgaagctctcggcaaagtccaccatgtgggttatgtattgggttgctgccgag
ggcttttatctgtgcatgagcatttccgtgtggatcgagggatcaggtgccatcctcgag
acgccggatccggtcgctgctttggatccgctatctatcgccaacgcgaggacggccatc
gccctggttttctttctttccggtgcgctcttgcagaaccaaagccaccgccatctggcc
agccttgagaagtactcgctgcccagcgcaggcatgttcaagtacatcatctgcccgcac
tacacggccgagtgtctggtgtacctaggcctcgcgctggccgcggcaccggaaggtcga
gtcttgaacacgacgctcctcgccgccctgctcttcacgttcacgaacctcgccatatca
gccaagacgactcgggactggtacagcgagaagttcggcgccgataaagtggccaagaag
tggaacatcttgccctttgtcttttga

DBGET integrated database retrieval system