KEGG   Thielavia terrestris: THITE_2122567Help
Entry
THITE_2122567     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ttt  Thielavia terrestris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3713242..3713454,3713520..3713728,3713788..3714772)
Genome map
AA seq 468 aa AA seqDB search
MSASEAAGAAPRKRTAYIALGSNIGDRIGWIERACNEMDARGIRVKRTSSLWETEPMYVL
DQDRFVNGACEVETTLEPLELLDALQDIEKALGREKLIDKGPRNIDLDILLYDNITFDHE
RLKIPHVGIPEREFVLRPLAELIPDKPIDPSRPWRLVADYLDALPPSKTPLTTMTPLSAH
HPPIQALNPSRKTHVMAILNMTPDSFSDGGQNAPHDTAALHQTIAGFLDAGATMIDIGGQ
STAPGAPEVSLDEELARVLPAIRLIRTAFAAQPVLISVDTYRARVAEAAVAAGADLVNDV
SGGALDPAMLPTVARLGTTVCLMHMRGTPATMASLADYPASEGGLVASIARELADRVRAA
EDAGVRRWRIVLDPGLGFAKVGRQNVDVLRHLDELRSWPGLQGLPWLVGSSRKSFIGRVT
GVPTPKERIWGTAATVAAAVQGGADVVRVHDVREMAQVVAMADAIWRY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttctgaagccgctggcgctgctccgcgcaagcggacggcgtacatcgccctg
ggcagcaacattggcgaccgcatcggctggatcgagagggcctgcaacgagatggacgcg
cggggcatcagggtgaagcggacgagcagtttgtgggagacggagcccatgtacgtgcta
gaccaggatagatttgtcaatggcgcctgcgaggtcgagacgaccctggagccactcgag
ttgctggatgcgctgcaggacatcgaaaaggcgctgggccgcgagaagctcatagacaag
gggccacgcaacatcgacctcgacattctgctctacgacaacatcacgttcgaccatgag
cgtctcaagatccctcacgttggcattcccgagcgggagtttgtcctgcgccccctggcc
gagctcattcccgacaaacccatcgacccctcacgcccgtggcgtctcgtcgccgactac
ctcgacgccctcccgccgtccaaaacgccgctgacgaccatgacgccgctctcggcgcac
cacccgcccatccaagcgctgaacccgtcccgcaaaacccacgtcatggccatcctcaac
atgacgcccgactccttctccgacggcggccagaacgccccgcacgacacggccgcgctc
caccagacgatcgcgggcttcctcgacgcgggcgccaccatgatcgacatcggcggccag
tcgaccgcgccgggcgcgcccgaggtctcgctcgacgaggagctcgcgcgcgtgctgccg
gccatccggctgatccgcacggccttcgccgcgcagccggtgctgatcagcgtcgacacg
taccgcgcgcgcgtggccgaggccgccgtcgccgcgggcgccgacctcgtcaacgacgtc
tccggcggcgccctcgacccggccatgctgcccaccgtcgcccgcctgggcaccaccgtc
tgcctgatgcacatgcgcggcaccccggccaccatggcctccctggccgactacccggcg
agcgagggcgggctggtcgccagcatcgcgcgcgagctggccgaccgcgtgcgcgccgcc
gaggacgccggcgtccgccgctggcgcatcgtgctcgaccccgggctagggttcgccaag
gtcggccgccagaacgtcgacgtgctgcgccacctggacgagctgcggagctggcccggc
ctgcagggcctgccgtggctggtggggtccagcaggaagagctttatcgggagggtgacg
ggggtgccgacgccgaaggagaggatctggggcaccgcggcgacggtggcggccgccgtg
cagggcggcgccgacgtggtgagggtgcacgacgtgcgcgagatggcgcaggtcgtcgcc
atggccgatgccatctggaggtattag

DBGET integrated database retrieval system