KEGG   Thielavia terrestris: THITE_2122567Help
Entry
THITE_2122567     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ttt  Thielavia terrestris
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THITE_2122567
Enzymes [BR:ttt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     THITE_2122567
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     THITE_2122567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(3713242..3713454,3713520..3713728,3713788..3714772)
Genome map
AA seq 468 aa AA seqDB search
MSASEAAGAAPRKRTAYIALGSNIGDRIGWIERACNEMDARGIRVKRTSSLWETEPMYVL
DQDRFVNGACEVETTLEPLELLDALQDIEKALGREKLIDKGPRNIDLDILLYDNITFDHE
RLKIPHVGIPEREFVLRPLAELIPDKPIDPSRPWRLVADYLDALPPSKTPLTTMTPLSAH
HPPIQALNPSRKTHVMAILNMTPDSFSDGGQNAPHDTAALHQTIAGFLDAGATMIDIGGQ
STAPGAPEVSLDEELARVLPAIRLIRTAFAAQPVLISVDTYRARVAEAAVAAGADLVNDV
SGGALDPAMLPTVARLGTTVCLMHMRGTPATMASLADYPASEGGLVASIARELADRVRAA
EDAGVRRWRIVLDPGLGFAKVGRQNVDVLRHLDELRSWPGLQGLPWLVGSSRKSFIGRVT
GVPTPKERIWGTAATVAAAVQGGADVVRVHDVREMAQVVAMADAIWRY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttctgaagccgctggcgctgctccgcgcaagcggacggcgtacatcgccctg
ggcagcaacattggcgaccgcatcggctggatcgagagggcctgcaacgagatggacgcg
cggggcatcagggtgaagcggacgagcagtttgtgggagacggagcccatgtacgtgcta
gaccaggatagatttgtcaatggcgcctgcgaggtcgagacgaccctggagccactcgag
ttgctggatgcgctgcaggacatcgaaaaggcgctgggccgcgagaagctcatagacaag
gggccacgcaacatcgacctcgacattctgctctacgacaacatcacgttcgaccatgag
cgtctcaagatccctcacgttggcattcccgagcgggagtttgtcctgcgccccctggcc
gagctcattcccgacaaacccatcgacccctcacgcccgtggcgtctcgtcgccgactac
ctcgacgccctcccgccgtccaaaacgccgctgacgaccatgacgccgctctcggcgcac
cacccgcccatccaagcgctgaacccgtcccgcaaaacccacgtcatggccatcctcaac
atgacgcccgactccttctccgacggcggccagaacgccccgcacgacacggccgcgctc
caccagacgatcgcgggcttcctcgacgcgggcgccaccatgatcgacatcggcggccag
tcgaccgcgccgggcgcgcccgaggtctcgctcgacgaggagctcgcgcgcgtgctgccg
gccatccggctgatccgcacggccttcgccgcgcagccggtgctgatcagcgtcgacacg
taccgcgcgcgcgtggccgaggccgccgtcgccgcgggcgccgacctcgtcaacgacgtc
tccggcggcgccctcgacccggccatgctgcccaccgtcgcccgcctgggcaccaccgtc
tgcctgatgcacatgcgcggcaccccggccaccatggcctccctggccgactacccggcg
agcgagggcgggctggtcgccagcatcgcgcgcgagctggccgaccgcgtgcgcgccgcc
gaggacgccggcgtccgccgctggcgcatcgtgctcgaccccgggctagggttcgccaag
gtcggccgccagaacgtcgacgtgctgcgccacctggacgagctgcggagctggcccggc
ctgcagggcctgccgtggctggtggggtccagcaggaagagctttatcgggagggtgacg
ggggtgccgacgccgaaggagaggatctggggcaccgcggcgacggtggcggccgccgtg
cagggcggcgccgacgtggtgagggtgcacgacgtgcgcgagatggcgcaggtcgtcgcc
atggccgatgccatctggaggtattag

  All links  
No link information was found.   
DBGET integrated database retrieval system