KEGG   Thielavia terrestris: THITE_2122629Help
Entry
THITE_2122629     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ttt  Thielavia terrestris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    THITE_2122629
Enzymes [BR:ttt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     THITE_2122629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3867626..3868102,3868177..3869788,3869839..3870035))
Genome map
AA seq 761 aa AA seqDB search
MRFSSWAVLLGAAARAVAGFDDEDEEVPREPTYFNGKKVPPMLGLTPDNWEKEYKASKYL
LVKHYSPYCPHCMDFAPTFQTLYEFYYTSSPAGDAPKNADFTSFYDFRFADINCVAYNDL
CAQHKVTSWPTTILYENGEPIVTLKGVKSMGVLSSAVEEVLEKAKPGTRPAKIELPQPGD
QTSPESNGASEAKASPGEKDKSSQEGTRDTTAKTDLKRKESSTMDEQTKKGADWVPPDFE
PPVPKVVKPKATPNPNGISVPLTAESFQTLVTATQEPWFIKFYAPWCHHCQKMAPNWEQL
AKEMKGRLNIGEVNCDAQSRLCKDFNVRGYPTILFFKGGERVEYQGLRGLGDFIQYAEKA
VELSNGIQDVDAESFEALEQKEEVIFLYFYDHATTSEDFLALERLPLSLIGRAKLVRTRD
PKLYDRFKITTWPRLLVSREGRPTYYTPLSPREMRDHNLVLNWMKSVWLPLVPELSATNA
REIMDGKIVVLGILNREDQDAFQSAIREMKSAANEWMDKQIQLFQLERQELRDAKQLRIE
EAEDRGDERALRNAKNIRINMDRSDRKEVTFAWVDAVFWQRWIRTTYGIDSTAGDRVIIN
DEDNRRYWDQTSTGNNIVPSRTSILETVNKVTANPPKIKPKFTIGFIEKIFFDIKTTFRE
HPYLSSGCVLGIAFGCLSWFRGGLASLFRRLLPCLLGLLSYLRGLLPWLRGALALVPWLR
ARLSRRRKGHFRLEDPPARDYKAPLLGAFANGGGGGAGKKD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcgagctgggcggtgctgctaggggcggccgcccgggccgtcgccggcttc
gacgatgaggacgaggaagtgccccgagaacccacatatttcaatgggaagaaggtccca
ccaatgctcgggctgacgcccgacaactgggagaaggaatataaggcctccaaatacttg
ctggtcaagcattacagcccgtactgcccgcattgtatggattttgcgccgacgtttcaa
acgttgtacgagttctactacacgtcatcgccggccggcgacgcgccgaaaaacgccgac
ttcaccagtttctacgacttccgcttcgccgacatcaactgcgtcgcgtacaacgacctg
tgcgcccagcataaagtgacatcatggccgaccaccatcctgtacgagaacggcgagccg
attgtgactctcaagggcgtcaagagcatgggcgtcctgagcagcgcggtggaggaagtg
ctggagaaggctaagccgggcacgcggcctgccaagatcgagctgcctcagccgggcgac
cagacatctcccgagtcgaatggcgcctctgaagcgaaggcatcaccaggcgagaaggac
aagtcgtcgcaagagggaacacgcgatacgaccgccaagaccgacttgaagcgaaaggaa
tcttcgaccatggatgagcaaaccaagaaaggggctgattgggtccctcccgacttcgaa
cctcccgttccgaaggtcgtgaagccgaaggcgactccgaaccccaacggcatctccgta
cccctcacggccgaaagttttcagaccctggtgaccgcgacgcaagagccctggttcatc
aagttctatgccccgtggtgccatcactgccagaagatggcgccgaactgggagcaactg
gccaaggagatgaagggtcggctcaacatcggcgaggtgaactgcgatgcgcaatctcgg
ctctgcaaggacttcaacgttcgtggctacccgaccatcctgttcttcaagggcggcgag
cgtgtcgagtaccagggtctccgtggcctgggcgactttatccagtatgccgagaaggcg
gtagagctgtcgaacgggatccaggatgtcgacgcggaatccttcgaggctctcgagcaa
aaggaagaggtcatcttcctctacttctacgaccacgccaccacgagcgaggacttcttg
gcgcttgagcgcctgcctctcagcctgatcggccgcgcgaagctggtccggacccgggac
cccaagctgtacgaccggttcaagatcactacgtggccccgcctgctagtctcgcgcgag
ggccggccaacgtattacacgccgctctctcccagggagatgcgggaccacaacctggtg
ctgaactggatgaaatcggtctggctgccgctcgtgccggagctcagcgcgaccaacgcg
cgcgagatcatggacggcaagatcgtcgtgctcggtattctgaaccgggaagatcaggac
gccttccagagcgccatccgggagatgaagagcgccgcgaacgagtggatggacaagcag
atccagctgttccagctggagcgccaggagctgcgcgacgccaagcagcttcgcatcgag
gaggccgaggaccgcggcgacgagcgagccctccggaacgccaagaacatcaggatcaac
atggaccggtccgaccgcaaggaggttacgtttgcgtgggtcgacgccgttttctggcag
cgatggatccgcaccacgtacggcatcgattccacggcaggggaccgagtcatcatcaac
gacgaggataaccggcgctactgggaccagaccagcacgggcaacaacatcgtcccgtcg
cgcacctccatcctcgagaccgtcaacaaggtcacggccaacccgcccaagatcaagccc
aagttcaccatcggcttcatcgagaagatcttcttcgacatcaagaccaccttccgggag
cacccctacctcagctccggctgcgtcctcggcatcgccttcggctgcctctcctggttc
cgcggcggcctggcctcgctgttccgccgcctgctgccctgtctcctcggcctgctgtcc
tacctccgcggcctgctgccctggctccgcggcgccctcgccctcgtgccctggctccgc
gccaggctgtccaggcgcaggaagggccacttcaggctggaggatccgccggctagggac
tataaggcgccgcttctcggcgcgtttgccaatggcggcgggggcggcgcagggaagaaa
gattga

  All links  
No link information was found.   
DBGET integrated database retrieval system