KEGG   Thielavia terrestris: THITE_2123426Help
Entry
THITE_2123426     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     THITE_2123426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(1035038..1035829)
Genome map
AA seq 263 aa AA seqDB search
MGKTSVTSRLNLPGRLGWLLMETPGFLTLLYTLRTLRSQTTTTAAAAAGSGGQEPPSLPY
QNQVLAALFVLHYTYRALLFPWLQPSMSPLHIIIFLSGVAFQLTNGLLLGAWLGAYGPTT
PAQWAAHLAPWPTAQFAAGLALFYLGLAANYYHDDELREIRRRRLRQARGKGGKGQGQGV
DKHYEIPQAGLFKVVLYPHYLVEWIEWVGFWMAAGWGCAPARCFVLNEVAAMLPRAVRGR
QWYVEKFGEEKIRGRWAVIPGVW
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaacctcggtgacctcgcgcctcaacctgcccggtcgcctgggctggctgctg
atggaaacgccaggcttcctgacgctgctgtacaccctgcgcaccctgcgctcccaaacc
accaccaccgccgccgccgccgccggcagcggcggccaagaacccccaagcctgccctac
caaaaccaagtcctggccgccctgttcgtgctgcactacacctaccgcgcgctgctcttc
ccctggctgcagccgtccatgtcgccgctgcacatcatcatcttcctctcgggcgtcgcc
ttccagctgaccaacggcctgctgctgggcgcgtggctgggcgcgtacggcccgaccacg
cccgcgcagtgggccgcgcacctggcgccctggccgaccgcgcagttcgccgccgggctg
gcgctcttctacctcggcctggccgcgaactactaccacgacgacgagctgcgggagatc
cgccgccgccggctgcggcaggcccgggggaagggagggaagggccagggacagggcgtg
gacaagcactatgagattccgcaggccgggctgttcaaggtcgtgctgtacccgcactac
ctggtcgagtggatcgagtgggtcggcttctggatggcggccgggtgggggtgcgcaccg
gcgcggtgctttgtgctgaacgaggtcgccgcgatgctgccgcgggcggtgcgcggtcgg
cagtggtatgtggagaagtttggggaggagaagatccggggccggtgggcggttattcct
ggggtgtggtga

DBGET integrated database retrieval system