KEGG   Thielavia terrestris: THITE_2123741Help
Entry
THITE_2123741     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ttt  Thielavia terrestris
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    THITE_2123741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1601658..1601682,1601757..1601851,1601936..1602126,1602530..1602545))
Genome map
AA seq 108 aa AA seqDB search
MGFSAGDAKKGANLFKTRCAQCHTLEAGGGNKIGPALHGLFGRKTGSVEGYAYTDANKQK
GITWDENTLFEYLENPKKYIPGTKMAFGGLKKDKDRNDLITYLKEATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctctgctggtgacgccaagaagggtgccaacctcttcaagacgcgctgcgcg
cagtgccacaccctcgaggcgggcggcggcaacaagatcggccccgcgctgcacggcctg
ttcggccgcaagacgggctccgtcgagggctacgcctacaccgacgccaacaagcagaag
ggcatcacctgggacgagaacactctgttcgaatacctcgagaaccccaagaagtacatt
cccggcaccaagatggccttcggcggtctgaagaaggacaaggacaggaacgacctgatc
acctacctcaaggaggccaccgcataa

DBGET integrated database retrieval system