KEGG   Thielavia terrestris: THITE_2123895Help
Entry
THITE_2123895     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2123895
   00052 Galactose metabolism
    THITE_2123895
Enzymes [BR:ttt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     THITE_2123895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1833375..1833587,1833657..1833751,1833840..1834707))
Genome map
AA seq 391 aa AA seqDB search
MRLLSKTLLSVLSGTAWVLDGVQAGAPVPRGQDVKGADKDGKYWIYGEGIAASFIPYGAS
ISNLLIKDKNGFVRDVVMGFDNASYYSIDKVHPHLGGVPGRYANRIKNSTFELDGQTYHV
TPNENPTAANPQGVDTLHGGPDGWDWRNFTVVAHTNRSITFSIVDPDGKEGFPGEVVSYI
TYTMGNMTWDGKMVAIATTKKTPIMLSSHTYWNLDGFSNNETNLILNHTFYLPYSGQRVA
VDNILIPTGEIVANPKGSVNDFWSAPKQIGKSWNDPEIHGNCGFNCTGYDTCFLVNRQKP
YDWRAPDGYVASLWSDWSGIRLKTTQGHPTGSSSSKTKFPRTVPQYGCVVLEVEDWIDGI
NYPEWGRLGRQVIEPGGDPYVLQFRYKFTVG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttctcagcaaaaccctcctctcggtgctctccggaaccgcctgggttctggat
ggcgtccaggctggcgctccggttccgcgtggccaagatgtgaaaggcgccgacaaagat
ggcaagtattggatctacggcgaggggattgctgcgtcgttcataccctacggagcctcg
atctcaaacttgctcatcaaagacaagaacggattcgtccgagacgtcgtgatggggttc
gataatgcgagctactactcgattgacaaggttcacccgcacctcggcggtgtccccggc
cgctatgcgaaccgcattaagaacagcacattcgagttggacggccagacctaccacgtc
actcccaacgagaaccccactgccgccaacccccagggcgtcgacacgctccacggtgga
ccggatggttgggactggcgcaactttacggtcgttgcccacaccaatcgatccattacc
ttctccattgtggatccggacggcaaggaaggcttcccaggcgaggtcgtctcgtacatc
acgtacacgatgggcaacatgacgtgggacggcaagatggtggccatcgctaccaccaag
aagacgcccatcatgctgagcagccatacctactggaacctggacggcttttccaacaac
gagaccaacctaatcctcaaccacacgttctacctgccctacagcggccagcgcgtggcg
gtggacaacatcctgatcccgaccggcgagatcgtggccaaccccaagggctcggtcaac
gatttctggagcgcacccaagcagatcgggaagagctggaacgaccccgagatccacgga
aactgcgggttcaactgcaccggctatgatacctgctttctcgtcaaccggcagaagccg
tacgactggcgcgctcccgacggctacgtggccagcctgtggtccgactggtccggcatc
cggctcaagacgacgcagggccaccccaccggctcgtcctcctccaagaccaagttcccg
cgcaccgtgccccagtacggctgcgtcgtgctggaggttgaggactggatcgacggcatc
aactaccccgagtggggccgcctgggcaggcaggtcatcgagcccggcggtgatccgtac
gtgctgcagttccgttataagtttaccgtgggctga

DBGET integrated database retrieval system