KEGG   Thielavia terrestris: THITE_2123958Help
Entry
THITE_2123958     CDS       T02228                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt00620  Pyruvate metabolism
ttt00640  Propanoate metabolism
ttt00680  Methane metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
ttt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2123958
   00620 Pyruvate metabolism
    THITE_2123958
   00640 Propanoate metabolism
    THITE_2123958
  Energy metabolism
   00680 Methane metabolism
    THITE_2123958
Enzymes [BR:ttt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     THITE_2123958
Lipid biosynthesis proteins [BR:ttt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   THITE_2123958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-GeneID: 11521838
NCBI-ProteinID: XP_003657844
JGI: Thite2_2123958
UniProt: G2RI46
Position
6:join(1914255..1914315,1914393..1914416,1914508..1914534,1914682..1915844,1915943..1916203,1916290..1916694,1916802..1916864)
Genome map
AA seq 667 aa AA seqDB search
MAEQAAKAPVVAEAHEVDTYHPPQKMLAKHPSKPHLSGLEEYQQLYKESITEPKKFWGRL
ARELLTWSKDFQTVQHGSLAEGNVAWFLEGELNASYNCVDRHAFKDPDRVAIIYEADEPT
DGRTVTYGELLREVSRVAHVLKDMGVRKGDTVAIYLPMIPEALVAILACARIGAIHSVVF
AGFSADSLRDRVIDAHSRVVITSDEGKRGGKLIGTKKIVDEALKKAPDVKHVLVFKRTGA
DIPMTQGRDYWWHEEVEKWPAYIAPEPMSAEDPLFLLYTSGSTGKPKGMMHTTGGYLVGA
AATAKYVFDIHEGDRYFCGGDVGWITGHTYVVYAPLLLGVSTVVFEGTPAYPNFSRYWDI
IEKHKVTQFYVAPTALRLLKRAGDQFVRNEMKHLRVLGSVGEPIAAEVWKWYFEVVGKEE
AHVVDTYWQTETGSHVITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIPGNDVEGVL
AFKQPWPSMARTVWGAHKRYRDTYLNVYKGYYFTGDGAGRDHEGFYWIRGRVDDVVNVSG
HRLSTAEIEAALIEHPAVAEAAVVGVADELTGQAVNAFVAVKDGNEPSDALRKEFILQVR
RSIGPFAAPKAVYIVPDLPKTRSGKIMRRILRKILAGEEDQLGDITTLSDPTVVEKIIVV
VHDAKKK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaagctgccaaggcccctgtggtggccgaggctcacgaagtcgacacgtac
cacccgccgcagaagatgctcgcaaagcacccgagcaagcctcacttgagcggtctcgag
gagtaccagcagctctacaaggagtccatcacagaaccgaaaaagttctgggggaggctg
gcccgcgagctcctgacctggagcaaggacttccagacagtgcagcatgggtctctggcg
gagggtaacgttgcctggttcctcgagggcgagctcaacgcgtcgtacaactgcgtcgac
cgtcatgccttcaaggaccccgaccgcgtcgccatcatctacgaggccgacgagccgacg
gacggccgcaccgtgacctacggcgagctcctgcgcgaggtctcgagggtcgcccacgtc
ctcaaggacatgggcgtgcgcaagggcgacaccgtggccatctacctgcccatgatcccc
gaggcgctcgtggccatcctcgcgtgcgcccgcatcggcgccatccactcggtggtcttc
gccggcttctcggccgactctctgcgcgaccgcgtcatcgatgcccactcccgggtcgtc
attacgtcggacgagggcaagcgcggcgggaagctcatcggcaccaagaagatcgtggac
gaggcgctcaagaaggcccccgatgtcaagcacgtgctcgtcttcaagcgcaccggcgcc
gacatccccatgacccagggccgcgactactggtggcacgaggaggttgagaagtggccc
gcctacatcgcgccggagcccatgagcgccgaagacccgctcttcctcctgtacacgtcc
ggctcgaccggcaagcccaagggcatgatgcacacgaccggcggctacctcgtcggcgcc
gccgccacggccaagtacgtcttcgacatccacgagggcgaccgctacttctgcggcggc
gacgtcggctggatcacgggccacacctacgtcgtgtatgcgccgctgctgctcggcgtg
tcgaccgtcgtcttcgagggcaccccggcgtatcccaacttctcccgctactgggacatc
atcgagaagcacaaggtcacccagttctacgtcgccccgaccgccctgcggctgctcaag
cgcgccggcgaccagttcgtgcgcaacgagatgaagcacctccgagtgctggggtccgtc
ggcgagcccatcgccgccgaggtctggaagtggtacttcgaagtcgtcggcaaggaggaa
gcccatgttgtcgacacgtactggcaaaccgagaccggctcccacgtcatcacccctctt
gccggcgtgacgcccacgaagcccggttccgcgtcgctgccgttcttcggcatcgagccc
gccatcatcgacccggtttcgggcgaggagatccccggcaacgatgtcgagggcgtcttg
gccttcaagcagccgtggccgagcatggcccgcaccgtctggggcgcgcacaagcggtac
agggacacatacctcaacgtctacaaggggtactacttcaccggtgacggagccggccgg
gaccacgagggcttctactggatccgcgggcgcgtcgacgacgtggtgaacgtcagcggg
caccggctgtcgacggccgagatcgaggcggcgctgatcgagcacccggccgtggccgag
gccgccgtggtcggcgtggcggacgagctcacgggccaggccgtcaacgccttcgtcgcc
gtcaaggacggcaacgagccgtcggacgcgctccgcaaggagttcatcctgcaggtccgc
cgcagcatcgggcccttcgccgcccccaaggctgtctacatcgtgcccgacctgcccaag
acccgcagcggcaagatcatgcgccgcatcctcaggaagatcctcgccggtgaggaggat
cagctgggtgatatcaccacgctttcggatccgactgtcgtcgagaaaatcattgtcgtt
gtccacgatgccaagaagaaataa

DBGET integrated database retrieval system