KEGG   Thielavia terrestris: THITE_2123958Help
Entry
THITE_2123958     CDS       T02228                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2123958
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2123958
   00620 Pyruvate metabolism
    THITE_2123958
   00640 Propanoate metabolism
    THITE_2123958
  Energy metabolism
   00680 Methane metabolism
    THITE_2123958
Enzymes [BR:ttt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     THITE_2123958
Lipid biosynthesis proteins [BR:ttt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   THITE_2123958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(1914255..1914315,1914393..1914416,1914508..1914534,1914682..1915844,1915943..1916203,1916290..1916694,1916802..1916864)
Genome map
AA seq 667 aa AA seqDB search
MAEQAAKAPVVAEAHEVDTYHPPQKMLAKHPSKPHLSGLEEYQQLYKESITEPKKFWGRL
ARELLTWSKDFQTVQHGSLAEGNVAWFLEGELNASYNCVDRHAFKDPDRVAIIYEADEPT
DGRTVTYGELLREVSRVAHVLKDMGVRKGDTVAIYLPMIPEALVAILACARIGAIHSVVF
AGFSADSLRDRVIDAHSRVVITSDEGKRGGKLIGTKKIVDEALKKAPDVKHVLVFKRTGA
DIPMTQGRDYWWHEEVEKWPAYIAPEPMSAEDPLFLLYTSGSTGKPKGMMHTTGGYLVGA
AATAKYVFDIHEGDRYFCGGDVGWITGHTYVVYAPLLLGVSTVVFEGTPAYPNFSRYWDI
IEKHKVTQFYVAPTALRLLKRAGDQFVRNEMKHLRVLGSVGEPIAAEVWKWYFEVVGKEE
AHVVDTYWQTETGSHVITPLAGVTPTKPGSASLPFFGIEPAIIDPVSGEEIPGNDVEGVL
AFKQPWPSMARTVWGAHKRYRDTYLNVYKGYYFTGDGAGRDHEGFYWIRGRVDDVVNVSG
HRLSTAEIEAALIEHPAVAEAAVVGVADELTGQAVNAFVAVKDGNEPSDALRKEFILQVR
RSIGPFAAPKAVYIVPDLPKTRSGKIMRRILRKILAGEEDQLGDITTLSDPTVVEKIIVV
VHDAKKK
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaagctgccaaggcccctgtggtggccgaggctcacgaagtcgacacgtac
cacccgccgcagaagatgctcgcaaagcacccgagcaagcctcacttgagcggtctcgag
gagtaccagcagctctacaaggagtccatcacagaaccgaaaaagttctgggggaggctg
gcccgcgagctcctgacctggagcaaggacttccagacagtgcagcatgggtctctggcg
gagggtaacgttgcctggttcctcgagggcgagctcaacgcgtcgtacaactgcgtcgac
cgtcatgccttcaaggaccccgaccgcgtcgccatcatctacgaggccgacgagccgacg
gacggccgcaccgtgacctacggcgagctcctgcgcgaggtctcgagggtcgcccacgtc
ctcaaggacatgggcgtgcgcaagggcgacaccgtggccatctacctgcccatgatcccc
gaggcgctcgtggccatcctcgcgtgcgcccgcatcggcgccatccactcggtggtcttc
gccggcttctcggccgactctctgcgcgaccgcgtcatcgatgcccactcccgggtcgtc
attacgtcggacgagggcaagcgcggcgggaagctcatcggcaccaagaagatcgtggac
gaggcgctcaagaaggcccccgatgtcaagcacgtgctcgtcttcaagcgcaccggcgcc
gacatccccatgacccagggccgcgactactggtggcacgaggaggttgagaagtggccc
gcctacatcgcgccggagcccatgagcgccgaagacccgctcttcctcctgtacacgtcc
ggctcgaccggcaagcccaagggcatgatgcacacgaccggcggctacctcgtcggcgcc
gccgccacggccaagtacgtcttcgacatccacgagggcgaccgctacttctgcggcggc
gacgtcggctggatcacgggccacacctacgtcgtgtatgcgccgctgctgctcggcgtg
tcgaccgtcgtcttcgagggcaccccggcgtatcccaacttctcccgctactgggacatc
atcgagaagcacaaggtcacccagttctacgtcgccccgaccgccctgcggctgctcaag
cgcgccggcgaccagttcgtgcgcaacgagatgaagcacctccgagtgctggggtccgtc
ggcgagcccatcgccgccgaggtctggaagtggtacttcgaagtcgtcggcaaggaggaa
gcccatgttgtcgacacgtactggcaaaccgagaccggctcccacgtcatcacccctctt
gccggcgtgacgcccacgaagcccggttccgcgtcgctgccgttcttcggcatcgagccc
gccatcatcgacccggtttcgggcgaggagatccccggcaacgatgtcgagggcgtcttg
gccttcaagcagccgtggccgagcatggcccgcaccgtctggggcgcgcacaagcggtac
agggacacatacctcaacgtctacaaggggtactacttcaccggtgacggagccggccgg
gaccacgagggcttctactggatccgcgggcgcgtcgacgacgtggtgaacgtcagcggg
caccggctgtcgacggccgagatcgaggcggcgctgatcgagcacccggccgtggccgag
gccgccgtggtcggcgtggcggacgagctcacgggccaggccgtcaacgccttcgtcgcc
gtcaaggacggcaacgagccgtcggacgcgctccgcaaggagttcatcctgcaggtccgc
cgcagcatcgggcccttcgccgcccccaaggctgtctacatcgtgcccgacctgcccaag
acccgcagcggcaagatcatgcgccgcatcctcaggaagatcctcgccggtgaggaggat
cagctgggtgatatcaccacgctttcggatccgactgtcgtcgagaaaatcattgtcgtt
gtccacgatgccaagaagaaataa

DBGET integrated database retrieval system