KEGG   Thielavia terrestris: THITE_2124116Help
Entry
THITE_2124116     CDS       T02228                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ttt  Thielavia terrestris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_2124116
Enzymes [BR:ttt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     THITE_2124116
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THITE_2124116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(2117307..2117342,2117401..2118031,2118087..2118422,2118497..2119188,2119247..2119362,2119431..2119530,2119583..2119707,2119796..2119880))
Genome map
AA seq 706 aa AA seqDB search
MDPIAVNSSNTLVGGGKVAGDDIPKDGTGVLKLDPWLSPFQDSLKRRYAKAQEWIKRLNE
TEGGLDKFSKGTDIFGLRVKGDGTIVYREWAPNAVRASLIGDFNKWDRKAHPMKKNEFGV
FEITIPPAADGKPAIPHNSKIKISLELPTAEWVDRLPAWIKYATQDLSISPAYDARFWNP
PAESRYSFKHERPKKPASLRIYEAHVGISSPELRVTTYKEFTKNMLPRIKNLGYNAIQLM
AIMEHAYYASFGYQVNNFFAASSRYGEPEDLKELVDVAHSLGLVVLLDVVHSHASKNVLD
GLNQFDGTDHQYFHEGGRGRHELWDSRLFNYGHHEVLRFLLSNLRFWMDEYRFDGFRFDG
VTSMLYLHHGIGTGFSGSYHEYFGPSVDEDAVVYLMLANEMLHTLYPEVITVAEDVSGMP
ALCLPLSLGGVGFDYRLAMAIPDMWIKILKEKKDEDWDIGNICWTLTNRRHGEKTIAYAE
SHDQALVGDKTLMMHLCDAELYTNMSVLGPLTPVIDRGMALHKMIRLLTHGLAGEGWLNF
EGNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDHLLRYQFLNNFDRSMNLCEDKYGWLH
APQAYISLKHEADKVIVFERAGVVFVFNFHPTQSFTDYRIGIEAPGTYRIVLDTDAKEHG
GFCRLDQSTRFFTQPLEWNGRKNCTHVYIPCRTALVLAPESTISQK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggatcccattgcggtgaactcgtcaaacacgctggtgggcgggggaaaagtggccgga
gacgatatccccaaggatggcaccggagtcttgaagcttgacccttggctctcgcctttc
caggactcgctgaagcgacgctacgccaaggctcaggaatggatcaagcggcttaacgag
accgaaggcggcctggacaagttcagcaaggggacggatatcttcggcctgcgagtgaaa
ggcgacggtaccattgtgtacagggaatgggcgcctaatgctgtccgagcttctctgatc
ggcgacttcaacaagtgggataggaaagcccatcctatgaagaagaatgagttcggtgtc
ttcgagattacaatcccgcccgccgctgacggcaagcccgcgataccgcacaactccaaa
atcaagatatccctcgagctcccaacggcagaatgggtcgacaggctgcccgcttggatc
aagtacgccacgcaggacctctccatctcgcctgcgtacgatgcccgcttctggaacccc
cccgcggaatccaggtactccttcaagcacgagcggcccaagaagcccgccagcctgcgc
atctacgaggcccacgtcggcatctcgtcgcccgagctgcgtgtcaccacctacaaggag
ttcaccaagaacatgcttccacgcattaagaacctgggttacaacgccatccagctcatg
gccatcatggaacacgcctactacgccagcttcggctaccaggtcaacaacttcttcgcc
gccagcagccggtacggcgagcccgaggacctgaaggagctagtcgatgtggcgcacagc
ctgggcttggtggtgctactcgacgtcgtgcacagccatgcgtccaagaacgtgctggac
gggctgaaccagttcgatggcacagaccatcagtacttccacgagggcggccggggccgg
cacgagctctgggacagcaggctcttcaactatggccaccacgaggtcctgcgcttcctg
ctcagcaacctgcgcttctggatggacgagtaccgctttgacggcttccggttcgacggc
gtgactagcatgctctatctgcatcacggcatcggaaccggcttctctggcagctaccac
gagtacttcgggcccagcgttgacgaagatgccgtcgtctatctcatgctggccaacgag
atgctccatacgctgtatccggaggtcatcaccgttgccgaggacgtgtcgggcatgcca
gcactatgcctgccgctctctctgggaggcgttgggtttgactataggcttgccatggcc
atcccggacatgtggatcaagatcctcaaggagaagaaggatgaggactgggacattggc
aacatttgctggactctgacaaaccgccgccacggggagaagacgattgcctatgccgag
agccacgaccaggccctggttggagacaagacgctcatgatgcacctctgcgacgccgag
ctgtacaccaacatgtcggtcctcgggccgctcactccggttatcgaccggggcatggcg
ctgcacaagatgatccggctgctgacgcacggcctggccggcgaaggctggctcaacttc
gagggcaacgagttcgggcacccagagtggctcgacttcccgcgcgagggcaaccagaac
tcgttctggtacgcgcggcggcagctgaacctgaccgaggaccacctgctgcggtaccag
ttcctcaacaacttcgaccgctccatgaacctctgcgaggacaagtacggctggctgcac
gcgccgcaggcctacatctcgctcaagcacgaggccgacaaggtcatcgtcttcgagcgc
gccggcgtcgtattcgtcttcaacttccacccgacccagagcttcaccgactaccgcatc
ggcatcgaggcccccggcacctaccgcatcgtgctcgacacggatgccaaggagcacggc
ggcttctgccgcctcgaccagagcacccgcttcttcacgcagccgctcgagtggaacggc
aggaagaattgcacccatgtttacattccgtgcaggactgctctggttctggcgcccgag
tcgacaatatcccagaagtaa

DBGET integrated database retrieval system