KEGG   Thielavia terrestris: THITE_2124488Help
Entry
THITE_2124488     CDS       T02228                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ttt  Thielavia terrestris
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ttt00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(2633752..2634339,2634396..2634454,2634515..2635274,2635335..2635832,2635889..2635943,2636014..2636144,2636265..2636405))
Genome map
AA seq 743 aa AA seqDB search
MASGNDRATVVSGADVGDAARRRNVPGTPQQVLVPQPQQPDDKKPKKEPSVLEILDEWEW
LIAPIIFTAFAFFTRFYKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPAGKLLVGLS
GYLAGYNGSFEFKSGETYPPEVNYTFMRQFNAFWGAICVPMAYWTAKELHLRRPAVWLVA
LMVLCENSYTTISRFILLDSMLLFGTVATTLCWAKFHNQRKNSFEPEWFFWLFMTGLSIG
FVTSVKLVGLFVTALVGLYTIEDLWNKFGDTKMPVTELAAHFFARVVGLIILPFLVYLLS
FAIHFAVLTNSGPGDAQMSSLFQANLRGTDVGRDSPLEVAYGSMVTIKNMGYGGGLLHSH
VQTYPEGSTQQQVTCYHHKDANNNWFFYPNRRDIPYDPAAEPRFIGDGEVIRLLHAQTGR
NLHSHQIAAPITKSQWEVSCYGNATIGDEKDHWKIEVVSDAASRDRSRIRTLTTAFRLRH
ETLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNIEAHVNEKLPPGNPGLYKSP
FLKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCGWDDSIVKYFLLGN
PLVYWGSTAALGVFAGLVAWYTIRWQRGYRELSPPELDQIHYAGLYPVAGWFLHYLPFVI
MARVTYVHHYYPALYFAILTFGFLADWFLRNQRAVAQYAAYALLYAAVIGLYIYFIPICW
GMTGPNRKYSYMKWFESWRMSDA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgggaaacgaccgggccactgtcgtctccggcgccgacgtgggcgacgcggcc
aggcgacgcaatgtcccgggcacgccgcagcaggtgctcgtcccacagccgcagcaacct
gacgacaagaagcccaagaaggagccctccgtcctcgagatactcgacgaatgggagtgg
ctgattgcccccatcatcttcactgctttcgccttcttcacccgcttctataagatcggt
ctctcgcccattgtcacttgggatgaagctcactttggaaagtttggcagccactacctg
aagcgcgagttctacttcgacgtgcacccccctgccgggaagctcctcgtcggcctgagc
ggatacctcgccggctacaatggatcgttcgagttcaagtccggcgagacctacccgccc
gaggtcaactacaccttcatgcgccagttcaacgccttctggggcgccatctgcgtgcca
atggcctactggaccgctaaggagctccacctgaggcgccctgctgtctggctcgtcgcc
ctgatggtcctctgcgagaactcgtacaccaccatcagccgcttcatcctgctggactcg
atgctcctgttcggcaccgtcgccacgactctctgctgggccaagttccacaaccagcgc
aagaacagcttcgagcccgagtggttcttctggctgttcatgaccggcctgagcatcggc
ttcgtgacgagcgtcaagctggtgggcctcttcgtcaccgcgcttgttggcctgtacacc
atcgaggacctgtggaacaagtttggtgacaccaagatgcctgtgaccgaactggctgcc
cacttctttgctcgcgtcgtgggcctcatcatcttgccgttcctggtctacctgctcagc
ttcgccatccactttgccgtgctcacgaacagcgggcctggtgacgcccagatgtcttcg
ctgttccaagccaacctccgcggcaccgacgtcggaagggacagccccttggaagtcgct
tatggctccatggtcacgatcaagaacatgggctatggcggcggcctcctccacagccac
gtccagacgtacccggagggttctacccagcagcaggtgacctgctaccaccacaaagat
gctaacaacaactggttcttctacccgaaccgccgcgatattccctacgaccccgccgcc
gagccccgcttcatcggcgacggcgaggtcatccgcctgctccatgcccagaccggccgc
aacctgcactcgcaccagatcgctgcccctatcaccaagtctcagtgggaggtttcttgc
tacggcaacgcgacgattggcgacgagaaggaccactggaagatcgaggtggtcagtgac
gctgcgtcccgcgaccgcagcaggatccgcaccctcaccacggccttccgcctgaggcac
gagactttgggctgctatctccgcgccggcaacgtcaacctgcctcagtggggcttcaaa
cagattgaggttacctgcaccaaggagaacaacccgcgcgatacctacacccactggaac
atcgaggcacacgtcaacgagaagctgccccctggaaaccccggcctgtacaagtcgcct
ttcctgaaggactttgtccacttgaacgtcgccatgatgacctcgaacaacgcgctcgtg
cccgacccggacaagcaggatgatctcgcctcgcagtggtggcagtggcccatcctgcac
gtcggcctgcgcatgtgcggctgggacgacagcatcgtcaagtacttcctcctcggcaac
ccgctcgtctactggggctcgacggccgcgctgggcgtcttcgccgggctcgtcgcctgg
tacacgatccgctggcagcgcggctaccgcgagctgtcgccgccggagctcgaccagatc
cactacgccggcctctaccccgtcgccggctggttcctgcactacctgcccttcgtcatc
atggcccgcgtcacctacgtccaccactactacccggccctctactttgccatcctcacc
ttcggcttcctcgccgactggttcctgcgcaaccagcgcgccgtcgcgcagtacgccgcc
tacgccctgctctacgccgccgtaatcggcctgtacatctacttcatccccatctgctgg
ggcatgaccggccccaacaggaagtacagctacatgaaatggttcgagagctggaggatg
tcggatgcgtga

DBGET integrated database retrieval system