KEGG   Thielavia terrestris: THITE_2124496Help
Entry
THITE_2124496     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     THITE_2124496
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   THITE_2124496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(2645817..2645931,2645986..2646134,2646208..2647193,2647266..2647329)
Genome map
AA seq 437 aa AA seqDB search
MSWKKTERLMDTIRHYASFPATGVSLRQMVQFGEKPSTGTLFRASQFLAEELPIRLAHRV
QELENLPDGLSEMPSVKKVADWYAQSFEEITALPRPELPKDVRERLMRPSKTSGKGTSWL
SEATPNPSIEEGQYNSWNGTNNGWAKGKFPATRRYFAVVDDTGDWPPELQLYNQKFAQTL
HRIKRRHDSVVTTMAQGILEYKRRRQRMQIDNNIQSFLDRFYMSRIGIRMLIGQHIALTD
QSQYRDPSYVGIICTKTYVRDLAQEAIENARFVCEDHYGLFEAPKIQLVCDPNLNFMYVP
GHLSHMLFETLKNSLRAVVETHGQDKQEFPVTKVIVAEGKEDITIKISDEGGGIPRSAIP
LVWTYMYTTVDRTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGT
DVYLHLNRLSSSSEPLQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagaagaccgagaggctgatggacaccatccgccactatgcaagctttcct
gccaccggcgtgagcttgcgccagatggtccagtttggcgagaagccatcaactgggact
ctcttccgcgcctcccagttcctcgccgaggagctccccatccgactggcccaccgcgtc
caagagctcgaaaacctgcccgacgggctcagtgagatgccatcggtgaagaaggtggcc
gactggtatgcgcagtcgtttgaggagatcacggccctccccaggccggagctacccaag
gatgtacgagagagattgatgaggccgtcgaagacatcgggcaaaggcacatcatggctg
agcgaggcgacaccgaatccaagcatcgaggagggccagtacaactcgtggaatggcacg
aacaacgggtgggccaagggaaaattccctgcgaccaggagatacttcgcagtggtggac
gacacgggcgactggccgcccgagctacaactgtacaaccagaaattcgcccagacgctg
caccgcattaagcgaagacacgacagcgtcgtcaccaccatggcgcaaggcatcctcgag
tacaaacgcagacggcaacggatgcagatcgacaacaacatacagtcatttctggaccgc
ttctacatgtctcgcattggcatacgcatgctcatcggccagcacattgccctgacggac
cagagccagtaccgcgacccgtcgtacgtcggcatcatctgcaccaagacgtacgtcagg
gacttggcccaggaggccatcgagaacgcccgcttcgtgtgcgaggatcactacggcttg
ttcgaggcgcccaagatccagctcgtgtgcgacccgaacctgaacttcatgtacgtgccg
ggccacctgtcgcacatgctcttcgagaccctcaagaactcgctgcgcgccgtcgtggag
acacacggccaggacaagcaggagttccccgtcacgaaggtgattgtggccgagggcaag
gaggacatcaccatcaagatctcggacgaagggggcggcatcccgcggagcgccatcccg
ctcgtgtggacatacatgtacaccaccgtcgaccggacaccgaacctggatccggacttt
gacaagagcgacttcaaggcgcccatggccggcttcggctacggcttgcccatctcgcgc
ctgtacgcgaggtactttggcggcgatctcaagctgattagcatggagggctacgggaca
gatgtttacctgcacctgaaccgcctgtcgagctcgtccgagcctctacaatag

DBGET integrated database retrieval system