KEGG   Thielavia terrestris: THITE_2124795Help
Entry
THITE_2124795     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ttt  Thielavia terrestris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THITE_2124795
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THITE_2124795
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THITE_2124795
Enzymes [BR:ttt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THITE_2124795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(3351671..3353369,3353439..3353671,3353762..3353920,3354021..3354068))
Genome map
AA seq 712 aa AA seqDB search
MEAITQTFQRCKAENRTALVTYVTAGFPTPELTPDVLLSMEKGGADVIELGVPFTDPIAD
GPTIQTSNTIALRNGVTIESTLQMVRDARKRGLRAPILLMGYYNPLLSYGEERLLTDCKE
AGVNGFIVVDLPPEEAISFRRLCTRGGLSYVPLIAPATSDARMRILCQLADTFIYVVSRQ
GVTGALGTLNAHLPELLARVKKYSGDKPAAVGFGVSTREHFVSVSQIADGVVVGSQIVTT
LQEAAKGEEAKAVQDFCSYLCGRTSSAQEEATREVGTIEAISDTKETNGDVHVDGVVSES
EDLVAQLAAMHGKIPERFGEFGGQYVPESLMDCLSELEEGFNKIKDDPAFWEEYRSYYPW
MGRPGHLHKAERLTEYVGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTKIIAETG
AGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMKLLGAKVVPVEAGSRTLRDAVN
EALRAWVVHLEDTHYIIGSAIGPHPFPTIVRTFQSVIGNETKAQMLEKRGKLPDAVVACV
GGGSNAAGMFYPFSNEPSVKLLGVEAGGDGLDTARHSATLAAGSKGVLHGVRTYILQNEH
GQIRDTHSVSAGLDYPGVGPELSNWKDMERAKFIAATDAEAFIGFRLMSQLEGIIPALES
SHGIYGAIQLAKTMDKDQDVVICLSGRGDKDVQSVADELPKIGPKIGWDLRF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaggccattacgcagaccttccagcggtgcaaggccgagaaccggactgcgctcgtt
acctacgtcacggccggctttcccacgcccgagctcaccccggatgtcctcctctctatg
gagaagggcggcgccgatgtcatcgagctcggcgtccccttcaccgatcccattgccgac
ggcccgacgattcagacttccaataccatcgctctccggaatggcgtcacaatcgaatca
acactgcagatggtccgggacgcccgcaagcgcggcctgcgtgcccccatcctgcttatg
ggctactacaaccccctcctaagctacggcgaggagcgtctcttgacggactgcaaggag
gccggagtcaacggcttcatcgtcgtcgatctgccgcctgaggaggccatctccttccgc
cgcctgtgcacccgtggaggcctctcttatgtgcccctcattgcccccgcgacgtcggac
gctcgcatgcgcatcctgtgccagctggctgatacgttcatctacgtcgtctcgcgacag
ggcgtgacgggcgcccttgggacgctcaatgcccacctccccgagctgctggcccgggtt
aagaaatacagtggggacaagcccgcggctgtcggattcggcgtcagcacccgcgaacat
ttcgtgtccgtctcccagattgccgacggtgttgtggtgggcagccagatcgtcacgacc
ctgcaggaggcggccaagggtgaggaggccaaggcggtccaggatttctgctcctatctt
tgcgggcgcacctcctccgcccaggaggaggccacgcgcgaggttggcaccatcgaggcc
atttccgacaccaaggagaccaatggtgatgtccacgtggatggcgttgtctccgaatcc
gaggatcttgttgcgcaactggccgccatgcatggaaagatccccgagcgcttcggcgag
ttcggtggacagtacgtgccagagtcgctcatggactgcctgtcggagctcgaggaggga
ttcaataagatcaaggacgaccccgccttctgggaggagtaccgctcgtactacccctgg
atgggccgccctggccacctgcacaaggccgagcggctgacagagtacgtcggcggcgcc
aacatctggctgaagcgcgaggatctcaaccacactggatcgcacaagatcaacaacgcg
ctcggccagctcctgcttgcgcgtcgcctcgggaagaccaagatcattgccgagacgggc
gccggccagcacggcgttgccacggctactgtgtgcgccaagttcggcatggaatgcacc
gtctacatgggcgccgaggacgtgcgccgccaggcgctgaacgtcttccgcatgaagctc
ctcggcgccaaggttgtccccgtcgaggccggcagccgcacgctccgcgatgccgtcaac
gaggccctccgcgcctgggttgtgcacctcgaggacacgcactacatcattgggtccgcc
atcggccctcatccgtttcccaccatcgtgcgcacgttccagtcggtcatcgggaacgag
accaaggcgcagatgctcgagaagcgcggcaagcttcccgacgccgtagtggcgtgcgtc
ggcggagggagcaacgccgccggcatgttctatccgttcagcaacgagccgagcgtcaag
cttctcggggtcgaggccggcggcgacggtctcgacacggctcgccacagtgcgacgctc
gccgccggcagcaagggcgtgctgcacggcgtgcgcacctacatcctgcagaacgagcac
ggccagatcagggacacgcactcggtctcggccggcctggactatcccggcgtggggccg
gagctgtccaactggaaggacatggagcgggccaagttcatcgctgccacggatgccgag
gcgttcatcggcttccggctgatgagccagctcgagggcatcatccccgcgctcgagtcg
tcccatggtatctacggcgctatccagctcgccaagaccatggacaaggaccaggacgtg
gtcatctgcttgagcggccgcggcgacaaggacgtgcagagcgttgccgacgagctgccc
aagatcggccccaagatcggctgggacctgcggttttga

DBGET integrated database retrieval system