KEGG   Thielavia terrestris: THITE_2124844Help
Entry
THITE_2124844     CDS       T02228                                 

Definition
glycoside hydrolase family 27 protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttt  Thielavia terrestris
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ttt00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ttt00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ttt00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ttt00603]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(3489072..3489179,3489241..3489334,3489402..3489639,3489719..3489925,3490029..3490590)
Genome map
AA seq 402 aa AA seqDB search
MKSALSTLFLGLAQLPIGESLDNGLGRTPLMGWSSWNVAQCNAASAKYALDTANKFVSLG
LKDLGYQYINIDDCWSTKSRNASGKLVPDPSKWPDGIKPVADKIHSMGLKFGLYGDAGQM
TCAGYPGSESHEASDVAQLVEWGVDFWKFDNCYTPCLDNPRPQTCSRPAGSTKTWYTPMR
DAIVGAQKLRNIYFNLCNWGRDNVWTWGAQYGNSWRISEDNWGDFASVARIASIAAGIYQ
YSAPGGFNDLDMLYIGSPKLTTNEERLHFGLWAITKSPLVLGLDLDNISDTRLAIIRNKG
IIDINQDPLGKAATTFRPPGAPAPVSGQVYPYWAGPLSDGVVIGLCAGTAAGTYTVNFTD
VPGLGAGTYTWKEMYTGQTGNGTSVSFNIDLHDMRVIKVTKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgcactgagcactctttttctgggcctagcccagttgcctatcggcgagtct
ctcgacaatggcctcggccggacgcctctcatggggtggagcagctggaacgttgcgcaa
tgcaacgctgcgtcggcgaaatacgcgctcgacaccgccaacaaattcgtttcccttggg
ctcaaggacctcgggtaccaatacatcaacatcgacgactgctggtccaccaagtcccgc
aatgcaagcggcaagctcgtgcccgatcccagcaagtggcccgacggcatcaaacccgtg
gccgacaagatccactccatgggcctgaagttcggcctctacggcgatgccggccagatg
acatgtgctggctaccccggcagcgagagtcacgaggcgtcagacgtcgcccagctagtc
gagtggggagttgatttctggaaatttgataactgctacacaccgtgtctggacaacccg
cgcccgcagacatgcagccgccccgcgggaagcacgaagacttggtacaccccgatgaga
gacgccatcgtgggtgcccagaaattacgcaatatttacttcaatctgtgcaactggggc
cgcgacaacgtctggacttggggtgcccagtacggaaattcctggagaatttcggaggat
aactggggcgatttcgcctcagtcgctcggatcgcatccattgcagcaggtatttatcaa
tacagcgcccccggcggcttcaacgacctcgacatgctctacatcgggtccccgaagctg
accacgaacgaggagagactgcacttcggtctgtgggccatcaccaagtctcccctcgta
ctgggcctcgaccttgacaacatctccgacacgaggctcgccatcatccgcaacaagggc
atcatcgacatcaaccaggaccccctgggcaaggccgccaccaccttccgcccgcccggc
gcccccgcgcccgtcagcggccaggtctacccctactgggccggcccgctcagcgacggc
gtcgtcatcggcctctgcgccggcaccgccgccggcacgtacaccgtcaacttcacggac
gtgccgggcctgggcgccgggacgtacacctggaaggagatgtacacgggccagacgggc
aatggcaccagcgtgtctttcaacattgatctacatgacatgcgcgtcatcaaggtcacc
aaggcgtga

DBGET integrated database retrieval system