KEGG   Thielavia terrestris: THITE_2124844Help
Entry
THITE_2124844     CDS       T02228                                 

Definition
glycoside hydrolase family 27 protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttt  Thielavia terrestris
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    THITE_2124844
  Lipid metabolism
   00561 Glycerolipid metabolism
    THITE_2124844
   00600 Sphingolipid metabolism
    THITE_2124844
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    THITE_2124844
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     THITE_2124844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(3489072..3489179,3489241..3489334,3489402..3489639,3489719..3489925,3490029..3490590)
Genome map
AA seq 402 aa AA seqDB search
MKSALSTLFLGLAQLPIGESLDNGLGRTPLMGWSSWNVAQCNAASAKYALDTANKFVSLG
LKDLGYQYINIDDCWSTKSRNASGKLVPDPSKWPDGIKPVADKIHSMGLKFGLYGDAGQM
TCAGYPGSESHEASDVAQLVEWGVDFWKFDNCYTPCLDNPRPQTCSRPAGSTKTWYTPMR
DAIVGAQKLRNIYFNLCNWGRDNVWTWGAQYGNSWRISEDNWGDFASVARIASIAAGIYQ
YSAPGGFNDLDMLYIGSPKLTTNEERLHFGLWAITKSPLVLGLDLDNISDTRLAIIRNKG
IIDINQDPLGKAATTFRPPGAPAPVSGQVYPYWAGPLSDGVVIGLCAGTAAGTYTVNFTD
VPGLGAGTYTWKEMYTGQTGNGTSVSFNIDLHDMRVIKVTKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgcactgagcactctttttctgggcctagcccagttgcctatcggcgagtct
ctcgacaatggcctcggccggacgcctctcatggggtggagcagctggaacgttgcgcaa
tgcaacgctgcgtcggcgaaatacgcgctcgacaccgccaacaaattcgtttcccttggg
ctcaaggacctcgggtaccaatacatcaacatcgacgactgctggtccaccaagtcccgc
aatgcaagcggcaagctcgtgcccgatcccagcaagtggcccgacggcatcaaacccgtg
gccgacaagatccactccatgggcctgaagttcggcctctacggcgatgccggccagatg
acatgtgctggctaccccggcagcgagagtcacgaggcgtcagacgtcgcccagctagtc
gagtggggagttgatttctggaaatttgataactgctacacaccgtgtctggacaacccg
cgcccgcagacatgcagccgccccgcgggaagcacgaagacttggtacaccccgatgaga
gacgccatcgtgggtgcccagaaattacgcaatatttacttcaatctgtgcaactggggc
cgcgacaacgtctggacttggggtgcccagtacggaaattcctggagaatttcggaggat
aactggggcgatttcgcctcagtcgctcggatcgcatccattgcagcaggtatttatcaa
tacagcgcccccggcggcttcaacgacctcgacatgctctacatcgggtccccgaagctg
accacgaacgaggagagactgcacttcggtctgtgggccatcaccaagtctcccctcgta
ctgggcctcgaccttgacaacatctccgacacgaggctcgccatcatccgcaacaagggc
atcatcgacatcaaccaggaccccctgggcaaggccgccaccaccttccgcccgcccggc
gcccccgcgcccgtcagcggccaggtctacccctactgggccggcccgctcagcgacggc
gtcgtcatcggcctctgcgccggcaccgccgccggcacgtacaccgtcaacttcacggac
gtgccgggcctgggcgccgggacgtacacctggaaggagatgtacacgggccagacgggc
aatggcaccagcgtgtctttcaacattgatctacatgacatgcgcgtcatcaaggtcacc
aaggcgtga

DBGET integrated database retrieval system