KEGG   Thielavia terrestris: THITE_2129056Help
Entry
THITE_2129056     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ttt  Thielavia terrestris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THITE_2129056
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     THITE_2129056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(8343368..8343388,8343418..8343951))
Genome map
AA seq 184 aa AA seqDB search
MATPPPRLPLITVLGSLNMDLVAYVPHHPVPGETLTADRFATSPGGKGANQAVACAKLSR
ARPASFASSSSQTQQQLGAGSGSGAGPAGAGGADSAAATTATATATARVSMVGRVGADAH
GAALRAGLAAFGVDVRRVAVVAAPGVDTGVALIVVDVPTGENRIVLSPGANYAFLPGECW
WWWW
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggccacccccccgccccgcctcccgctcatcaccgtcctcggctccctcaacatggac
ctcgtcgcctacgtcccgcaccaccccgtgccgggcgagaccctcaccgccgaccgcttc
gccacgtcgcccggaggcaagggcgccaaccaggccgtcgcgtgcgccaagctctcgcgc
gcgcggccggcttcttttgcttcttcttcttctcaaacccagcagcagcttggtgctggt
tctggctctggtgctggccccgctggtgccgggggggccgactcggcagcggcgacgacg
gcgacggcgacggcgacggcgcgcgtcagcatggtcgggcgcgtgggggcggacgcgcac
ggcgcggcgctgcgcgcgggcctggcggcgttcggcgtcgacgtgcggcgcgtcgcggtg
gtggccgcgcccggcgtcgacacgggcgtcgcgctgatcgtcgtcgacgtccccaccggc
gagaacaggatcgtgctctcccccggcgcgaactacgctttcctccctggggagtgttgg
tggtggtggtggtga

DBGET integrated database retrieval system