KEGG   Thielavia terrestris: THITE_2141433Help
Entry
THITE_2141433     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ttt  Thielavia terrestris
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THITE_2141433
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     THITE_2141433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(4310710..4310789,4310854..4310925,4310995..4311622,4311727..4311784,4313526..4313690,4313765..4315377,4315509..4315589))
Genome map
AA seq 898 aa AA seqDB search
MAVLTQTKVATAASIALRALSYIFLRWIIPALVFTLFAIYVPALISSYRNEPKCDLVDEV
DVMITETAVEGENAVENETQPEERGGRSANGDKEVVADDVTIRETISIENRPLNAWQTLL
TGAPNPRSLALTLGALLLNGLCVGFVADRLFRERYYPNDGLSFVRVGYVSEKEAKLLIRE
PDQSKMPVSVEVRIKDPQPPFDNPLWQSAGGVRWTTNDTDYTAVVTVPLRHPKRRTYEWR
TSNNHSGEFTVPPPAGHAEDTNYGPFTFLSTSCIVPRLPYNPFDHPLSIPGFKHLAKVLP
SLNAQFMLFLGDFIYADVPRYWDKSTAYYREKYRQIYASPDWPAVGQNLSWIHVLDDHEI
ANDWSANSTGVYDKAIDPFYRYQAALNPPPAPQAGARTARAGNTAYFAFTQGPASFFLLD
TRSFRSSNALPTDDANKTMLGPDQLADLLAWLRRPEPKGVKWKIVASSVPFTKNWPVNGK
DTWGGFLAERRKVLEVMWDVASRGVGVVVLSGDRHEFAATKFPPPEDGAWPESATVWEFS
VSPLSQFYTPFPTYKQTDREDVLVKYIHKGNSKFGAITIENLEGGEQSSLKYRLFIDGAE
VWNTVVLSPPPVVGGKSSGSIQMWDSKIAKSLPTVDYEAKRIGFVIVENTPFDDPNRTKE
LLERIGPIRVTHYGGFYDFTPNLAMADTAYTNEALPPHTDTTYFTEPAGLQAFHLLSHQP
APGASADEAAVSGGKTVLVDGFQAARFLQQIDKPAWTTLTKVAVPWHASGNAGITIAPDK
LYPVLELRGQLGPNGVHRIRWNNADRGVVPFNWTETPQMWYKAARKWNELLSREDFQCWL
QLEPGKVLIFDNWRVLHGRSAFTGIRRICGGYINRDDFISRWRNTNYKREEVIDRVLG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcagtactgacacagacgaaggtcgcaaccgcggcctcaatcgcgctgcgtgccctg
tcatacatcttcctgcgatggatcatccccgccctcgtttttacgcttttcgctatctat
gtgcctgctctcatctcaagctaccggaacgagccgaagtgcgacttggttgatgaagtc
gatgtcatgatcactgagaccgccgtggagggcgagaacgctgtggagaacgaaacccaa
cccgaagagagaggcggccggtcggccaacggcgacaaggaggtcgttgccgatgatgtt
accatccgggaaaccatttccattgagaacaggccgctgaatgcctggcagaccctgctg
actggcgcgccaaacccacgaagcctggccctgacccttggcgcgctcctcctcaacggt
ctctgtgttggcttcgtggccgaccgtctattccgggagcgctactaccccaatgacggc
ctgtccttcgtgagggttggctatgtgtctgagaaggaggccaagctcctgattcgtgag
ccagaccagtccaagatgcccgtcagcgtggaggttcgcatcaaggacccccaacctccg
tttgacaatccgctgtggcagagcgccggcggcgtgaggtggacgaccaacgatactgac
tacactgcggtcgtaactgtccccttgcgacacccgaagaggaggacatacgaatggcgc
acctcaaacaaccattctggcgagttcacggttcctccgccggccggccatgcagaggac
accaactacggtccctttaccttcttgtccacctcatgcatcgtgccgcggcttccctac
aatccgtttgatcatcccctttccatcccgggcttcaagcacctcgccaaggttctccct
tcgctcaacgcccagttcatgctcttcctgggcgacttcatctatgccgacgttccgcgc
tactgggacaaatccaccgcatactaccgcgaaaagtaccgccaaatctacgcctccccg
gactggccggccgtcggccagaacctcagctggatccatgtcctcgacgaccacgagatc
gccaacgactggtccgccaactcgacaggcgtctacgacaaggccatcgaccctttctac
cgctaccaggcggcgcttaacccgccgccggcgccccaagccggcgcgcggaccgcccgc
gccggcaacacggcgtactttgccttcacccagggcccagccagcttcttcctcctcgac
acgcgctcgttccgctcgagcaacgcgctgccgacggacgacgccaacaagacgatgctc
gggccggaccagctggccgatctcctggcctggctgcgccgaccggagcccaagggcgtc
aagtggaagatcgtggcctcgtccgtgccgttcaccaagaactggccggtcaacgggaag
gacacctggggcggcttcctcgccgagcggcggaaggtgctcgaggtcatgtgggacgtg
gcgagccgcggcgtcggggtcgtcgtgctgagcggcgaccggcacgagttcgccgcgacc
aagttcccgccgcccgaggacggcgcctggcccgagagcgctaccgtctgggagttctcg
gtcagcccgctcagccagttctatacgcctttcccgacgtacaagcagaccgatcgggag
gatgtgttggtcaagtacatccacaagggtaactccaagtttggcgccatcaccattgag
aacctggagggcggcgagcagagcagtctgaagtacaggctattcatcgatggcgcagag
gtgtggaatacggttgttctgtcaccgccgccggttgtgggcggcaagagcagtggctcc
atccagatgtgggactctaagattgcgaagtcgcttccaaccgtcgactatgaagcaaaa
cgaatcggcttcgtcatcgttgagaacaccccgttcgacgaccctaacaggacgaaggag
ctcctagagcgcattggacctatcagggtcacgcactacggcggcttctacgactttacc
ccgaaccttgccatggccgacacggcttacaccaacgaggccctgccaccccacaccgac
accacctacttcaccgaacctgccggcttgcaggctttccacctgctttctcaccagccg
gcgcccggcgccagtgctgacgaggccgcggtctccggcggcaagacggtgctcgtggac
gggtttcaggcagcgcggttcctacagcaaattgacaagccggcctggactactctgacg
aaggtcgcagtcccctggcacgccagcgggaatgcggggataaccatcgctcccgacaag
ctgtacccagtgctagagctcagaggacagctaggtcccaatggcgtgcataggatacgg
tggaacaatgcggacaggggtgtggttccatttaactggacggaaacccctcaaatgtgg
tacaaagccgcgcggaaatggaacgagcttctgtcgagggaggactttcagtgctggctc
caactggaacctggcaaggtgctcattttcgacaactggcgcgtgctccacggccgcagc
gctttcacgggtatcaggaggatctgcggaggatacatcaacagagacgacttcatctcc
cgctggagaaatacgaactacaagcgggaagaagtcattgacagagttttggggtag

DBGET integrated database retrieval system