KEGG   Thielavia terrestris: THITE_2144773Help
Entry
THITE_2144773     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    THITE_2144773
  Amino acid metabolism
   00380 Tryptophan metabolism
    THITE_2144773
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     THITE_2144773
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     THITE_2144773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(9467158..9468042,9468113..9469567,9469632..9470405,9470479..9470655))
Genome map
AA seq 1096 aa AA seqDB search
MTSATADKTEQIPGPPGYPLVGNALSIDRETPLSTWEGWADQYGEIFRVTLPQGTVVIVS
SQRLVHELCDEKRFHKPVRGALQEIRNAVHDGLFTAREDEPSWGIAHRILMPAFGPASIQ
GMFDEMHEVASQLALKWARHGADADIMVTDDFTRLTLDTLALCAMDFRFNSYYHDDLHPF
INAMAGFLTESGARALRPGLVSVFFREANRKYWDDIEVLRRTAQGVLDSRRKHPTGRRDL
LAAMLEGIDPKTGQKLSDASIIDNLITFLIAGHETTSGLLSFAFCQLIKHPAAYRKAQEE
VDRVVGSGPIRVEHMKKLPYIAAVLRETLRLCPTIPVIARRANEDTVIGGKYAVPKGQSF
LLLLARSHVDPAVYGESARGFVPERMLDDNFERLMKEYPDCWKPFGIGMRACIGRPFAWQ
EAMLVMTMLLQNFDFALSDPSYELRYKQTLTTKPKDFYMRATLRHGLTPTTLERRLAGGS
SPESSGAAQQQPAANSKPNGVARPLSAAARADAKPMSIFYGSNTGTCESLAHRLATDAAA
HGFAATVIEPMDAATEKLPTDRPVVVITASFEGQPPDNAAAFCGWLGRLKAAELQGVSYA
VFGCGHHDWNQTFHRVPKLVDGTMAARGASRICEAGLSDVAQGDMFSDFEQWEDDVFWPA
IGAKYGTAGAAAANGDEHGGDPLSASLEVRFSTPRSSTLRQDVKEARVVEERTLTAPGAP
PKKHIDIQLPAGMSYKVGDYLAVLPVNPKDSVSRVMRRFHLSWDSHITIDSDQLTALPTG
TPVPVSDVLGSYVELSQPATKRGILRLAEAAGDDATKQQLQALAGGDAYAREISLKRASI
LDLLERFPSVALPFGTFLSLLPPMRPRQYSISSSPSGAAGPARATLTYSLLDAPALANPA
VRHVGVATAYLASLLPGDQLQLSVRPTHTAFRLPNDSHKTPIICVAAGAGLAPFRGFIQE
RAVAAARGSAKSLAPALLFFGCRGPQLDDLYRAEFDAWQAQGAVDVRRAYSRAAAEETAE
AKGCRHVQDRLWYDRDEVRALWERGARVYVCGSRAVGEAVRRMLGRILLGADAGEDEIAR
WYEGVRNARYATDVFD
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggcaacggcggacaagacagagcagataccaggcccgccgggctacccactg
gtgggcaatgcgctctccatcgaccgcgagaccccgctgagcacgtgggagggctgggcc
gaccagtatggcgagatattccgcgtcacgctccctcaggggaccgtagtcatcgttagc
tctcaaaggctggtgcacgagctctgcgacgagaagcggtttcacaaacccgtcaggggc
gcgctccaggagatccgcaacgccgtgcatgacggcctcttcacggcgagggaggacgag
cccagctggggcatcgcacaccgcatcctgatgccggcgttcggcccggcatcgatccag
ggcatgttcgacgagatgcacgaggtcgcgtcgcagctggcgctcaagtgggcacgccac
ggcgccgacgccgacatcatggtgacagacgacttcacgcgcctgacgctcgacacgctc
gccctgtgcgccatggacttccgcttcaactcgtactaccacgatgacctgcaccctttc
atcaacgccatggccggcttcctgaccgagtcgggtgcccgcgcgctgcggcccggcctg
gtgtcggtcttcttccgcgaggcaaaccgcaagtactgggacgacatcgaggtgctgcgc
cgcacagcccagggcgtgctcgactcgcgccgcaagcaccccaccggccgccgcgacctg
ctggccgccatgctcgaaggcatcgaccccaagacgggccagaagctgagcgacgcgtcc
atcatcgacaacctcatcaccttcctcatcgccggccacgagaccacgtcgggcctgctg
agcttcgccttctgccaactcatcaagcacccggcggcctaccgcaaggcgcaagaggag
gtcgaccgcgtggtcggcagcgggccgatccgggtggagcacatgaagaagctcccctac
atcgcagcagtcctccgcgagacgctgcggctttgtccgaccatccccgtgatcgcgagg
cgcgccaacgaggacaccgtcatcggcggcaagtacgccgtgcccaagggccagagcttc
ctgctgctgctggcgcgctcgcacgtagacccggccgtgtacggcgagagcgcccgcggc
ttcgtgccggagcgcatgctcgacgacaacttcgagcgcctgatgaaggagtacccagac
tgctggaagccgttcggcatcggcatgcgcgcctgcatcggccgcccgttcgcctggcag
gaggccatgttggtgatgaccatgctgctgcagaacttcgacttcgccctgtccgacccc
agctacgagctgcgctacaagcagacgctgaccaccaagcccaaggacttctacatgcgc
gccaccctgcgccacggcctcacgcccaccaccctggagcgccgtctcgccggcggttca
agtcctgagtcgtcgggcgccgcgcagcagcagccggcagccaattccaaaccgaacggg
gtggcccgtccgttgtccgcggcggcccgggcggacgcgaagccgatgagcatcttctat
ggctccaacacgggcacctgcgagagcctcgcccaccgcctcgccaccgacgcggccgcc
cacggcttcgcggcgaccgtgatcgagccaatggacgcggcgaccgagaagctgcccacg
gaccggcccgtcgtcgtcatcacggcctcgtttgagggccagccgccggacaacgccgcc
gcgttctgcggctggctcggccggctcaaggcggccgagctgcagggcgtgtcgtacgcc
gtcttcggctgcggccaccacgactggaaccagacgttccaccgggtccccaagctcgtc
gacggcaccatggccgcgcgcggcgcgtcgcgcatctgtgaggcgggcctgtcggacgtg
gcccagggcgacatgttctccgactttgagcagtgggaggacgacgtgttctggccggcc
atcggagcaaagtacggcacggcgggcgctgctgccgccaacggggacgagcacggcggc
gacccgctgtcggccagcctcgaggtgcgcttctccacgccccggtcgtcgacgctccgc
caggacgtcaaggaggccagggtggtcgaggagcgcaccctgacggcgcccggggcgccg
cctaagaagcacatcgacatccagctgcccgccggcatgtcgtacaaggtgggcgactac
ctcgccgtgctgcccgtgaaccccaaggacagcgtcagccgggtgatgcggcgcttccac
ctctcgtgggactcgcacatcaccatcgactcggaccagctgacggccctgccgacgggg
acgcccgtgcctgtgtccgacgtgctggggtcgtacgtcgagctgtcgcagccggcgacg
aagaggggcatcctccgcctcgccgaggccgccggcgacgacgccacgaaacagcagctg
caggccctcgcaggtggcgacgcgtacgcgcgggagattagcctcaagcgggcgtccatc
ctcgacctactcgagcggttcccgtccgtggcgctccccttcggcaccttcctgtcgctg
ctcccgccgatgcgcccgcggcagtactccatctcatcgtcgccgtccggcgccgccggc
cccgcccgcgcgacgctgacctacagcctccttgacgcgcccgcgctcgccaacccggcc
gtgcgccacgttggcgtcgccaccgcctacctcgcctccctcctccccggcgaccagctg
cagctgtccgtgcgcccgacccacaccgccttccgcctgcccaacgacagccacaagacg
cccatcatctgcgtggccgccggcgccgggctagcccccttccgcgggttcatccaggag
cgcgcggtggcggcggcgcggggcagcgccaaaagcctggcgccggcgctcctcttcttc
ggctgccgcggcccgcagctcgacgacctctaccgggccgagttcgacgcctggcaggcg
cagggcgccgtcgacgtgcggcgggcgtacagccgtgccgccgcggaggagacggccgag
gcgaagggctgccggcacgtgcaggaccggctgtggtacgaccgcgacgaggtcagggcg
ctgtgggagcggggcgcgcgcgtctacgtgtgcggctcgcgcgccgtcggcgaggctgtc
agacggatgctcggccggatcctgctgggcgcagacgccggcgaggacgagatcgcgcgg
tggtatgagggcgtgcgcaatgctcggtatgccacggatgtgtttgattaa

DBGET integrated database retrieval system