KEGG   Thielavia terrestris: THITE_2144773Help
Entry
THITE_2144773     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ttt00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ttt00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(9467158..9468042,9468113..9469567,9469632..9470405,9470479..9470655))
Genome map
AA seq 1096 aa AA seqDB search
MTSATADKTEQIPGPPGYPLVGNALSIDRETPLSTWEGWADQYGEIFRVTLPQGTVVIVS
SQRLVHELCDEKRFHKPVRGALQEIRNAVHDGLFTAREDEPSWGIAHRILMPAFGPASIQ
GMFDEMHEVASQLALKWARHGADADIMVTDDFTRLTLDTLALCAMDFRFNSYYHDDLHPF
INAMAGFLTESGARALRPGLVSVFFREANRKYWDDIEVLRRTAQGVLDSRRKHPTGRRDL
LAAMLEGIDPKTGQKLSDASIIDNLITFLIAGHETTSGLLSFAFCQLIKHPAAYRKAQEE
VDRVVGSGPIRVEHMKKLPYIAAVLRETLRLCPTIPVIARRANEDTVIGGKYAVPKGQSF
LLLLARSHVDPAVYGESARGFVPERMLDDNFERLMKEYPDCWKPFGIGMRACIGRPFAWQ
EAMLVMTMLLQNFDFALSDPSYELRYKQTLTTKPKDFYMRATLRHGLTPTTLERRLAGGS
SPESSGAAQQQPAANSKPNGVARPLSAAARADAKPMSIFYGSNTGTCESLAHRLATDAAA
HGFAATVIEPMDAATEKLPTDRPVVVITASFEGQPPDNAAAFCGWLGRLKAAELQGVSYA
VFGCGHHDWNQTFHRVPKLVDGTMAARGASRICEAGLSDVAQGDMFSDFEQWEDDVFWPA
IGAKYGTAGAAAANGDEHGGDPLSASLEVRFSTPRSSTLRQDVKEARVVEERTLTAPGAP
PKKHIDIQLPAGMSYKVGDYLAVLPVNPKDSVSRVMRRFHLSWDSHITIDSDQLTALPTG
TPVPVSDVLGSYVELSQPATKRGILRLAEAAGDDATKQQLQALAGGDAYAREISLKRASI
LDLLERFPSVALPFGTFLSLLPPMRPRQYSISSSPSGAAGPARATLTYSLLDAPALANPA
VRHVGVATAYLASLLPGDQLQLSVRPTHTAFRLPNDSHKTPIICVAAGAGLAPFRGFIQE
RAVAAARGSAKSLAPALLFFGCRGPQLDDLYRAEFDAWQAQGAVDVRRAYSRAAAEETAE
AKGCRHVQDRLWYDRDEVRALWERGARVYVCGSRAVGEAVRRMLGRILLGADAGEDEIAR
WYEGVRNARYATDVFD
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggcaacggcggacaagacagagcagataccaggcccgccgggctacccactg
gtgggcaatgcgctctccatcgaccgcgagaccccgctgagcacgtgggagggctgggcc
gaccagtatggcgagatattccgcgtcacgctccctcaggggaccgtagtcatcgttagc
tctcaaaggctggtgcacgagctctgcgacgagaagcggtttcacaaacccgtcaggggc
gcgctccaggagatccgcaacgccgtgcatgacggcctcttcacggcgagggaggacgag
cccagctggggcatcgcacaccgcatcctgatgccggcgttcggcccggcatcgatccag
ggcatgttcgacgagatgcacgaggtcgcgtcgcagctggcgctcaagtgggcacgccac
ggcgccgacgccgacatcatggtgacagacgacttcacgcgcctgacgctcgacacgctc
gccctgtgcgccatggacttccgcttcaactcgtactaccacgatgacctgcaccctttc
atcaacgccatggccggcttcctgaccgagtcgggtgcccgcgcgctgcggcccggcctg
gtgtcggtcttcttccgcgaggcaaaccgcaagtactgggacgacatcgaggtgctgcgc
cgcacagcccagggcgtgctcgactcgcgccgcaagcaccccaccggccgccgcgacctg
ctggccgccatgctcgaaggcatcgaccccaagacgggccagaagctgagcgacgcgtcc
atcatcgacaacctcatcaccttcctcatcgccggccacgagaccacgtcgggcctgctg
agcttcgccttctgccaactcatcaagcacccggcggcctaccgcaaggcgcaagaggag
gtcgaccgcgtggtcggcagcgggccgatccgggtggagcacatgaagaagctcccctac
atcgcagcagtcctccgcgagacgctgcggctttgtccgaccatccccgtgatcgcgagg
cgcgccaacgaggacaccgtcatcggcggcaagtacgccgtgcccaagggccagagcttc
ctgctgctgctggcgcgctcgcacgtagacccggccgtgtacggcgagagcgcccgcggc
ttcgtgccggagcgcatgctcgacgacaacttcgagcgcctgatgaaggagtacccagac
tgctggaagccgttcggcatcggcatgcgcgcctgcatcggccgcccgttcgcctggcag
gaggccatgttggtgatgaccatgctgctgcagaacttcgacttcgccctgtccgacccc
agctacgagctgcgctacaagcagacgctgaccaccaagcccaaggacttctacatgcgc
gccaccctgcgccacggcctcacgcccaccaccctggagcgccgtctcgccggcggttca
agtcctgagtcgtcgggcgccgcgcagcagcagccggcagccaattccaaaccgaacggg
gtggcccgtccgttgtccgcggcggcccgggcggacgcgaagccgatgagcatcttctat
ggctccaacacgggcacctgcgagagcctcgcccaccgcctcgccaccgacgcggccgcc
cacggcttcgcggcgaccgtgatcgagccaatggacgcggcgaccgagaagctgcccacg
gaccggcccgtcgtcgtcatcacggcctcgtttgagggccagccgccggacaacgccgcc
gcgttctgcggctggctcggccggctcaaggcggccgagctgcagggcgtgtcgtacgcc
gtcttcggctgcggccaccacgactggaaccagacgttccaccgggtccccaagctcgtc
gacggcaccatggccgcgcgcggcgcgtcgcgcatctgtgaggcgggcctgtcggacgtg
gcccagggcgacatgttctccgactttgagcagtgggaggacgacgtgttctggccggcc
atcggagcaaagtacggcacggcgggcgctgctgccgccaacggggacgagcacggcggc
gacccgctgtcggccagcctcgaggtgcgcttctccacgccccggtcgtcgacgctccgc
caggacgtcaaggaggccagggtggtcgaggagcgcaccctgacggcgcccggggcgccg
cctaagaagcacatcgacatccagctgcccgccggcatgtcgtacaaggtgggcgactac
ctcgccgtgctgcccgtgaaccccaaggacagcgtcagccgggtgatgcggcgcttccac
ctctcgtgggactcgcacatcaccatcgactcggaccagctgacggccctgccgacgggg
acgcccgtgcctgtgtccgacgtgctggggtcgtacgtcgagctgtcgcagccggcgacg
aagaggggcatcctccgcctcgccgaggccgccggcgacgacgccacgaaacagcagctg
caggccctcgcaggtggcgacgcgtacgcgcgggagattagcctcaagcgggcgtccatc
ctcgacctactcgagcggttcccgtccgtggcgctccccttcggcaccttcctgtcgctg
ctcccgccgatgcgcccgcggcagtactccatctcatcgtcgccgtccggcgccgccggc
cccgcccgcgcgacgctgacctacagcctccttgacgcgcccgcgctcgccaacccggcc
gtgcgccacgttggcgtcgccaccgcctacctcgcctccctcctccccggcgaccagctg
cagctgtccgtgcgcccgacccacaccgccttccgcctgcccaacgacagccacaagacg
cccatcatctgcgtggccgccggcgccgggctagcccccttccgcgggttcatccaggag
cgcgcggtggcggcggcgcggggcagcgccaaaagcctggcgccggcgctcctcttcttc
ggctgccgcggcccgcagctcgacgacctctaccgggccgagttcgacgcctggcaggcg
cagggcgccgtcgacgtgcggcgggcgtacagccgtgccgccgcggaggagacggccgag
gcgaagggctgccggcacgtgcaggaccggctgtggtacgaccgcgacgaggtcagggcg
ctgtgggagcggggcgcgcgcgtctacgtgtgcggctcgcgcgccgtcggcgaggctgtc
agacggatgctcggccggatcctgctgggcgcagacgccggcgaggacgagatcgcgcgg
tggtatgagggcgtgcgcaatgctcggtatgccacggatgtgtttgattaa

DBGET integrated database retrieval system